(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE149

CAGLA1_12.PE149      Location/Qualifiers
FT   CDS_pept        complement(393154..393990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501144"
FT                   /locus_tag="CAGL0M03465g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62473.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191130"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI00003B7072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU7"
FT                   /transl_table=1
FT                   /translation="MSDKDQGSAQLAGDHQEYQNKNYDSDVENMAGGDHEIGKIYTSGA
FT                   NNEYIYIGRQKFLKTDLYEAFGGTLNPGLAPPSSHKFANPAPLGLSAFALTTFVLSMFN
FT                   AKAQGIVVPNVVVGLAMFYGGLVQLIAGIWEIALENTFGATALCSYGGFWLSFGAIYIP
FT                   WFGILEAYKDKESDLGNALGFYLLGWTIFTYGLTLCTLKSTVAFFALFFLLALVLLLLS
FT                   IGEFSGKVGCKRAGGVVGVVVAFIAWYNAYAGVASRQNSYIVAHPFPLPTNEKTLY"
     atgtctgaca aagatcaagg aagcgcccaa ctagctggcg atcaccaaga gtatcaaaac        60
     aagaactacg actctgatgt cgaaaacatg gctggtggag accacgaaat tggcaagatc       120
     tacacatctg gtgccaacaa cgagtacatc tacattggta gacagaagtt cttgaagact       180
     gacctgtacg aggctttcgg tggtactttg aacccaggtc ttgctccacc ttcaagccac       240
     aagtttgcta acccagcccc attgggtctg tctgctttcg ctctaaccac ttttgtgcta       300
     tctatgttca acgccaaggc tcaaggtatt gtggttccta acgttgttgt cggtttggct       360
     atgttctacg gtggtcttgt ccaattgatc gccggtattt gggaaatcgc tttggaaaac       420
     acttttggtg ccactgctct gtgctcctac ggtggtttct ggttgagttt cggtgctatt       480
     tacattccat ggttcggtat cctagaagcc tacaaagata aagaaagtga cttgggtaac       540
     gccctaggtt tctacctact gggctggacc attttcactt acggtttgac tttgtgtaca       600
     ttgaagtcta ccgttgcttt ctttgcacta ttcttcctac tggctctggt cttgctatta       660
     ttgtctattg gtgaattctc aggcaaagtt ggctgtaaga gagctggtgg tgtcgtcggt       720
     gtcgtcgtcg ctttcattgc ttggtacaac gcttacgcag gtgtcgccag cagacaaaac       780
     tcttacattg ttgctcaccc attcccattg ccaacaaacg aaaagaccct atactaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page