(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE151

CAGLA1_12.PE151      Location/Qualifiers
FT   CDS_pept        complement(398183..400981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348985"
FT                   /locus_tag="CAGL0M03531g"
FT                   /product="Similar to uniprot|P32074 Saccharomyces
FT                   cerevisiae YNL287w SEC21"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAG62475.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG022373"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI00003B7074"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU5"
FT                   /transl_table=1
FT                   /translation="MSTSTYKKFEQAGSSDLPDKMTIYQDCMNTFNETPVNPKRCRLLI
FT                   SRLLRLLAQGETFPRNEATALFFSISKLFQYPNDSLRQLVYLAIKEFSGISEDVLMATS
FT                   SIMKDVQNGSDLVKPNAIRSLTNVLDESTAFSAERLLKSALVSKHPSISSAALCTSYHL
FT                   LPISEVTVKRFTNETQEAVVDLKQFPSSSMNGEYYPNSTYITQYHALGLLYQLKKNDKM
FT                   ALLKLVRQFSEGNVLKNQLAKVELVRIVSELIQKDPQLFTQFKPLLNNWLSNKFESVQL
FT                   ETAKMITSFAIHNPRLVSPELYAAAISALQSLLSVPRVSTRFATLRILNRISMISPEKI
FT                   AICNPELESLVNDSNRNISTYAITTLLKTGTAKNISSLIHTITRFIHDVSDDFKIIIVD
FT                   AVRTLSLNFPQEWKSIVTFLIDVLKNSEGGFKYKNSIVEALIDIVSFVPQSKELALENL
FT                   CDFIEDCEYNEILVRILHLLGKEGPSTTNPSLYVRHIYNRVVLENSIIRSAAVVALSKF
FT                   ALTKNDSTLCESIISLLKRIVHDKDDEVRDRASIALKFIEAAKEKNDKVANDLIQSSSA
FT                   YDLSSLESKLSAYLSSNTDSFQTPFDSQSIPKYAEDELKAMELKKKQEKIFENKGDKTR
FT                   DSSKTESTSNSAGENFNAEAEYDDGKDDLLAAKYAEEMAAIPEINAFGSIVNTTKAVPL
FT                   TEPEAEFVVTGIKHLFADHVVIQFNIRNTLTDVILDNVSVSCVPEESGDVTLEEQFTIP
FT                   IDRLLPSAESSCYVAFKKPEAIVTETFMNSINFTTREVNPDTNEPFEGDEGFEDEYEID
FT                   PITLSGGDYVKSSFVGNFTSAFDELPHEEIAVYNIQEDISIQEVVDKVIQNTSCLPLGS
FT                   TQYVGGDSNSHTLKLFGKSALTGSKIGMLVKFIKSSKGVALKVQGKAEDATLCADLVNS
FT                   VI"
     atgtccacgt caacatataa gaagttcgag caggcgggct cctccgatct tcctgataag        60
     atgactatct atcaggattg tatgaacaca ttcaatgaga ctcctgtcaa cccaaagaga       120
     tgtagattgc ttatttctcg tcttttgaga ctgttggcac aaggtgaaac tttcccaagg       180
     aacgaagcta ccgccttatt cttctcgatc tcgaagttgt ttcaataccc taacgattcc       240
     ttgagacaac tggtttactt ggccatcaaa gagttcagtg gtatttcaga ggatgtctta       300
     atggctactt cttccattat gaaagatgtg caaaacggtt ctgacctggt taagccaaat       360
     gccatcagat cattaacaaa tgtcttagat gagtctaccg ctttctccgc cgaaagatta       420
     ctgaaaagtg ctttggttag caaacatcca tcgatctctt ctgctgcctt gtgtacttct       480
     taccatctat tgccaatctc tgaagttacc gtcaagagat tcaccaatga aacacaagaa       540
     gccgttgttg atttgaaaca gttcccaagc tcaagcatga atggcgagta ttacccaaac       600
     tccacttaca tcacacaata ccatgctctg ggtctattat accaattaaa gaaaaatgac       660
     aaaatggctt tgttgaagtt ggttagacaa ttctctgaag gcaatgtttt gaagaaccaa       720
     cttgcgaagg ttgaattggt gagaatagtc agcgaattga ttcaaaagga cccacaatta       780
     ttcacgcaat ttaagccatt gttgaacaac tggctgtcaa acaagtttga atctgtgcaa       840
     ttagaaactg ctaagatgat cacttctttt gccattcaca acccaagatt ggtttctcca       900
     gaactttatg ctgccgctat ctctgccttg caatccttgc taagtgtacc tcgtgtttct       960
     acaagatttg caactttgcg tatcctaaac agaatttcta tgatttctcc agaaaagatt      1020
     gccatctgta acccagagct agaatctcta gtaaacgact ccaacagaaa catctctact      1080
     tatgctatca ctactttgct aaagacaggt acagctaaga atatttcatc tttgattcac      1140
     accattacaa ggtttattca tgatgtttcc gacgacttca agatcattat cgttgatgcc      1200
     gtgcgtacac tatctttgaa tttcccacaa gaatggaagt ccattgtcac tttcttgatt      1260
     gatgtactaa agaatagtga aggtggtttc aagtataaga acagtatcgt ggaagctttg      1320
     attgatattg taagcttcgt tcctcaatca aaggaacttg cactagagaa tctgtgtgac      1380
     tttattgaag actgtgaata taacgaaata ttagtcagaa ttctgcatct attgggtaaa      1440
     gaaggtccaa gtaccaccaa cccatctcta tacgttagac acatttacaa cagagttgtt      1500
     ctagaaaact ccattattag atctgccgct gtagtagctt tatcaaagtt cgcgctaaca      1560
     aagaatgatt ctactctttg tgaatccatt atcagtcttt tgaagagaat tgttcatgac      1620
     aaggatgacg aagttagaga cagagcatcc attgctttga agtttataga agcagcaaag      1680
     gagaagaatg ataaagttgc caacgatctt atccaatcta gttccgctta tgacctatcc      1740
     tctttggagt ctaagctttc tgcttaccta tcttccaaca ccgactcctt ccaaactcca      1800
     tttgactctc agagtattcc aaagtatgct gaagatgaat taaaggcgat ggaattgaag      1860
     aagaagcaag agaagatctt cgaaaacaaa ggtgacaaga ctagagattc aagcaagaca      1920
     gaatctacat ccaacagtgc tggagagaac ttcaatgctg aagctgaata cgatgatggt      1980
     aaggatgacc tattggctgc caagtatgcc gaggagatgg ctgctatccc agagataaac      2040
     gctttcggat ctatagtgaa taccactaag gctgtaccac taacagaacc agaagccgag      2100
     tttgttgtca ctggtatcaa gcatctcttt gccgaccatg ttgtcattca attcaacatc      2160
     aggaacactt tgaccgatgt tatcttggat aatgtttctg tttcctgtgt tccagaagaa      2220
     tctggtgatg ttaccctgga agaacaattc accattccaa ttgatagact actacctagt      2280
     gcggaatcat cctgttatgt cgccttcaag aagccagagg ctattgtcac agagactttc      2340
     atgaacagca ttaacttcac gactagagaa gttaacccag acaccaatga gccatttgag      2400
     ggtgatgaag gtttcgaaga tgagtacgag atcgatccaa tcacactaag tggtggtgac      2460
     tatgtcaaga gttcgtttgt tggtaacttc acctctgcgt ttgacgagct tccacacgaa      2520
     gaaatcgctg tgtataacat ccaagaagat atcagcatac aagaagtagt agataaagtc      2580
     atccaaaaca ccagctgtct tccacttggt agcacacagt atgttggtgg tgactccaac      2640
     tctcatacat tgaagctatt cggtaagagt gcactaactg gctccaagat cggtatgtta      2700
     gtcaaattca tcaagagttc caagggtgtt gcattgaagg tccaaggtaa agcagaagat      2760
     gccactctat gtgcggacct tgttaacagt gttatttaa                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page