(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE156

CAGLA1_12.PE156      Location/Qualifiers
FT   CDS_pept        complement(408582..410747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044613"
FT                   /locus_tag="CAGL0M03641g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62480.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG058940"
FT                   /db_xref="HOGENOM:HBG397500"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B7079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU0"
FT                   /transl_table=1
FT                   /translation="MSSENLIDDAGVVSETTQPQEVHGSTDAPARTQDSDDVPKSNRAV
FT                   LSTAGLRLTHASRSDLKKPVLGFPKKSPSLPNFHENVQSDNENNSDPTLSKLLDESKFV
FT                   HNSHRLNFSLLKDDQPIDESDDTSGIETKEVKIEVKSQLHVPKTHKRTATLGGVSMNED
FT                   DGNLSVIDMYGDEVESRVSKPQVPAEATQVDNDESQDEEVPPHAGSNTSENPGQHNTEK
FT                   ATTEAAMTQEMLREQQIKADRRQSTFHYDRYGFKKQTNYVSEAKYDSWWNEYSQYCIRR
FT                   KHKWKQLLEKSGLPVDNDSPTRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARGQDLLNR
FT                   NKDRYDQLLERMEILLSSDKKKIQDLDIIERDLHRTFPDNLHFQHNSYHGDEPPLISSL
FT                   RRVLVAFSLYNPKIGYCQSMNFLAGMLLLFLDEERAFWMLVIITSRYLPGVHNVNLEGV
FT                   NIDQAVLMLCIKEYLPEIWPYINPELKTINKTSNSLGIKNGGSTGVKNEFLYKLPPITL
FT                   CTASWFMGCFVGVMPVETTLRVWDCMFYEESHFLFKISLAIFKLCENDLSKVRNNGSSL
FT                   LPNYMNGNHKSMSKDESDMEVFQIIQVFPKSLIDPNDIFDKIILKKRLSFNRLDQEEID
FT                   RCRKYVATQRQKYKKFHDNGKNATFSGVNEDVPPAGESGTRIASDTINEALSSEIYGFK
FT                   KGLTGVHWNNSIKEKVRQMRKKIDKDD"
     atgtcttctg agaatcttat tgatgatgcc ggtgttgtct ctgagactac tcaaccgcaa        60
     gaagttcatg gatcaacaga tgcaccagca cgtacacagg actcagacga tgtaccgaaa       120
     agtaatagag cagtacttag cacagcaggt ttgagattaa ctcatgcaag taggagtgac       180
     ttgaaaaaac ctgtacttgg ttttccaaag aagtcaccat cgttgcctaa ctttcatgaa       240
     aatgttcagt cagataatga aaataatagt gatccaacat tatctaaact actagatgaa       300
     tccaaatttg tccataattc gcataggttg aatttcagct tattgaagga cgaccagcca       360
     atcgatgaga gtgacgatac aagtggtatc gaaaccaaag aagttaagat tgaggtcaaa       420
     tcacagttgc atgtgccgaa aacgcataaa agaacagcca cactaggtgg agtatctatg       480
     aatgaagatg atggaaatct tagcgtcata gatatgtatg gggatgaagt agaatcgaga       540
     gtctcgaagc cgcaggttcc ggcagaggct acacaggttg acaatgatga gagtcaagat       600
     gaggaagtcc cgccacatgc tggatcaaac acatcagaaa atcctggaca acataataca       660
     gaaaaagcta caaccgaagc tgcaatgact caagaaatgc tgagggagca gcaaataaaa       720
     gctgataggc gccagagcac tttccactac gatcgttatg ggttcaaaaa acaaactaat       780
     tacgtcagtg aggcaaaata tgatagttgg tggaatgaat actcccaata ttgcataaga       840
     agaaaacata aatggaagca attacttgaa aagagtggtc tacctgtaga taatgacagt       900
     ccaactagat ttccatcaaa aagtgaaaag ttgaaaaggt atgtaagaaa gggtatccct       960
     gctgaatgga gaggaaatgc ttggtggtat tttgctcgtg gtcaggacct actaaatagg      1020
     aacaaagaca gatatgacca actgctggaa agaatggaaa ttttactttc atctgataag      1080
     aagaaaatac aagacctgga tattattgag agggatttac atagaacatt ccctgataac      1140
     ttgcattttc aacacaactc gtaccatgga gatgagcctc ccttaataag ttctcttaga      1200
     agggttttgg tggcattttc gctatataac ccaaaaatcg gttattgtca atctatgaat      1260
     ttcttggcag gtatgttgct tttgttctta gatgaagaac gtgcgttttg gatgctcgtg      1320
     ataataacat ctaggtacct tcctggagtt cataatgtca acttagaagg ggtgaatatt      1380
     gatcaagcgg tattaatgtt atgcatcaaa gaatatctgc ctgaaatttg gccttatatt      1440
     aatccggagt tgaagacgat caataagaca agcaactcgt tgggaataaa aaatggaggt      1500
     tcaactggtg ttaaaaacga atttttatat aaattaccac caattacact atgtactgct      1560
     agttggttta tgggttgttt tgttggtgtt atgcctgtag aaaccacatt aagggtctgg      1620
     gattgtatgt tttatgaaga atcacatttc ttattcaaga tctcactggc aatattcaag      1680
     ctttgtgaaa acgatttaag caaagtaaga aataatggaa gttcattact tccaaattac      1740
     atgaatggaa atcataaatc aatgagcaaa gatgaaagtg atatggaagt ctttcaaatc      1800
     attcaggtct tcccgaaatc gttaatcgat ccaaacgata tatttgataa aataattctg      1860
     aagaaaagat tgtctttcaa ccgtttggat caagaggaaa tagataggtg taggaaatat      1920
     gttgctacac agaggcaaaa atacaaaaag ttccacgata atgggaaaaa tgctacgttt      1980
     agtggtgtta acgaagatgt accacctgca ggagaatcag gaacaagaat cgcgagtgat      2040
     accattaatg aagcattgtc gtccgagatt tatgggttta agaaaggtct cactggggta      2100
     cattggaata atagcataaa ggagaaagtc agacagatga ggaaaaagat agataaggat      2160
     gactaa                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page