(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE157

CAGLA1_12.PE157      Location/Qualifiers
FT   CDS_pept        411533..413152
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437838"
FT                   /gene_name="RIM21"
FT                   /locus_tag="CAGL0M03663g"
FT                   /product="pH-response regulator protein palH/RIM21 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG62481.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124042"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI00003B707A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJT9"
FT                   /transl_table=1
FT                   /translation="MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVYA
FT                   KNVKWSSFCDYGVPLYLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTILM
FT                   VYSTIFVITVALTVLSFLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISRQQE
FT                   HYGVANGNVFGTLLNSNLVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFVGGIM
FT                   SIVSFIISAIVSYTDRVGIRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTRKTWVS
FT                   HLQMWYLALLTIAIVLLSPAMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEWLERIHI
FT                   LKKAAQVKSLLGQKIYEDEQEGYNFAYYSVNNESNLDTNSDSHISLYNDMFRNSEQFSN
FT                   VGSNLSSKESSSLPAQMNSTGISFPTAVNQVEFQKRKSFLDHLTNFTYSRPYKIYKKSK
FT                   SIIQLRKRNSETVKNERSNEELSIEKVRRRLGLTNERREYVYNTKDIVFASDDDTESEC
FT                   ESNNILNESIDSHFPENGAGSV"
     atggctgtat ctatatatga ttccttgagg acaccgggtc caaagcacta taaatacaag        60
     atctgtgacg gtatcgattt aggggatggt ttagtgattg atccattgaa tctggattct       120
     cttgttgtct atgctaaaaa tgtcaaatgg agtagcttct gtgactatgg ggttccttta       180
     tacctggcgg ctgatactat ggatacacct tatgaatatc cacccattat catgaatgat       240
     tggcgttggt ttatatttaa tgaccattac ttcggcaagt actggggcta cggtctctat       300
     actattctaa tggtttatag taccatattt gttattacag ttgcgttgac agtattatcc       360
     tttttaactg ttaacaaggg tccctacaaa atcacttcac ttcttctaaa actttcgtcg       420
     gtgctggcat cgactagtat aatatacttt ctaacttctg cattatctac tattagtaga       480
     caacaagaac actacggtgt agccaatggt aatgtttttg gaacattgtt aaattcaaat       540
     ttagttatcg ccacccttaa ccttctgtca atgtttttct acaaactatg ccaggtatca       600
     attgtagcca gattattcga aagaaaacta gaatggagaa tagttgtatt tgtcggtggg       660
     ataatgagca tagtttcatt tataatatcg gctattgtct cctatactga tcgtgttgga       720
     attagaaatg acaatctggt gacgttaagt ccattcgggc tgctgttcga tatagcattg       780
     gaaacctgtt ttgcatttat tatagtaact aacgtttggg ggacaagaaa aacatgggta       840
     agtcatttgc agatgtggta ccttgcctta ttaactattg caatcgtatt actaagtcct       900
     gcaatgtttt tagctgatgt cggcacaggg ttattatctg catatgctgc cactgtcagt       960
     cccctactat acacaatgag tacatttgtt gcctgggagt ggttagaacg tatccatata      1020
     ttaaagaaag ccgcccaagt aaaaagttta ttaggacaaa agatttatga ggatgagcaa      1080
     gagggttata actttgctta ttattctgtt aataatgaga gcaaccttga caccaactca      1140
     gactcacata tatccttata caatgatatg ttccgtaatt ccgaacaatt ctcaaacgtt      1200
     gggagcaacc tctctagtaa ggagtcgtca tcactacctg cacagatgaa ctcaaccggt      1260
     atttcttttc caacagctgt taatcaagta gaatttcaga aaaggaaatc attcctggac      1320
     cacctcacta actttaccta ttcaagacct tataaaattt acaagaagtc aaaatcaatt      1380
     attcaattaa gaaagaggaa tagcgagaca gtcaaaaatg aaaggtctaa tgaagagcta      1440
     tcaattgaaa aggtaagaag aaggttggga ctaacaaatg aaagaagaga gtatgtgtat      1500
     aacactaaag atattgtatt cgcttctgat gatgatacag aatctgagtg cgaatcaaac      1560
     aatatactaa acgaatccat tgatagccat tttccagaaa atggggctgg gtctgtttga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page