(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE160

CAGLA1_12.PE160      Location/Qualifiers
FT   CDS_pept        complement(420316..422901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437841"
FT                   /locus_tag="CAGL0M03729g"
FT                   /product="Similar to uniprot|P48562 Saccharomyces
FT                   cerevisiae YNL298w CLA4"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62484.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B707D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT6"
FT                   /transl_table=1
FT                   /translation="MSLSAAAAKISDSDFQSIGPAPRPPVSAGGAAFNKTQPITRYMSQ
FT                   LDLNSGRANRSNSNVRRKSGWVSYKDDGLLSFLWQKRFMVLNDSALTLYKNEKVTEDPV
FT                   LKIPLTVIVSVSKNQLKQYCFELTRVSERNSSNGGQSGNTDSMAKKTIYIATKTETDLI
FT                   SWLDSIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWN
FT                   NDSAAVIQVLNFYQEYNNGEGSTYGAGSTTSVSSGSTNSSQINLLKDTNTSTNSSDKVS
FT                   PISQANSMVPQRRAPSPPKQSSTVNSVNSVNVVPSQNSSQQAINMPNRSNTPIRQGSSP
FT                   YQNNISSKNNMAPRMQAPSPAGGNKIQNSLPKLATHNNYNQQQGFVNKYPSPGSSPGSS
FT                   QPPSPINGYRPHHNMSNPYANKGPGSPLNARPNQQTTIQNQVPFNQRNGSQQQSNYPMK
FT                   VYPTIPVLKQPQQGGGYPNQNVIQNQTSVNAANMAMRQQQQQQNKINQNNPPAALQPVR
FT                   QAPKKPAGVSKDGAEKAKKTSKPTMSNAEIMSKLKQVTLDADPSTLFKMIEKAGQGASG
FT                   SVYLAERTEIIEADGPQHQRGGTEHEDPLIGDKVAIKQMVLSKQPRKELIVNEIMVMND
FT                   SRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVR
FT                   ETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYW
FT                   MAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQS
FT                   LSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNIACEPEDLTSLLENKK"
     atgtctctat cagcagctgc ggctaaaata tcagacagtg atttccaaag tataggtccc        60
     gcacctaggc cacctgtgag tgccggaggg gcagccttca acaagacaca gcccatcacc       120
     aggtacatga gccagctcga tctcaatagc ggacgcgcaa atcgatctaa tagcaatgtc       180
     aggaggaaat cgggttgggt ttcatacaaa gatgatggtt tgctgtcgtt tctgtggcaa       240
     aaaagattca tggtgctaaa tgattcggcg ttaacattat acaagaacga gaaagttact       300
     gaggatcccg tcttgaagat tcctctgact gttatcgtca gtgtcagcaa gaaccagttg       360
     aaacagtact gctttgagct gacccgtgta tcagaaagaa actcgagcaa tggtggccaa       420
     tctggtaata ccgattccat ggctaagaag accatatata tcgcaacgaa aacagagacc       480
     gatctcatct catggttgga ttcgatcttc gctaaatgtc ctctattaag tggagtatct       540
     tctccaacaa attttactca taaagtgcat gtagggtttg atccagagac cggaagcttt       600
     gttggtatgc caacaaactg ggaaaaactg ttgaagcact ctagaatcac cggcgaggac       660
     tggaataatg actctgcagc tgttattcaa gttttaaact tttatcaaga atataataat       720
     ggtgaaggtt ccacgtatgg cgctggaagc actacatcgg tctcttctgg gagtactaac       780
     agctcacaga tcaatttgtt aaaggacacc aacacatcta ctaattctag tgataaggta       840
     tctccaatat cacaagctaa ttctatggtc cctcaaagaa gagctccttc acctccaaag       900
     caatcatcta cagttaattc cgttaattct gtgaatgtag ttcctagtca aaattcttct       960
     caacaagcga ttaatatgcc aaacaggtcc aataccccaa ttaggcaggg tagctcccca      1020
     taccaaaaca atatatcctc gaagaacaac atggcaccaa gaatgcaagc gccatctcca      1080
     gcaggtggaa acaaaattca aaactcactt ccaaaacttg ctactcataa taattacaat      1140
     caacaacaag gttttgttaa taagtatcct tctccaggtt cttctccagg ttcttctcag      1200
     ccaccttcgc cgattaatgg ctacagacca catcataata tgagtaatcc atacgcaaac      1260
     aagggacccg ggtctccttt aaatgcaagg cccaatcagc aaacaactat acaaaaccaa      1320
     gtacctttca atcaaagaaa tggttcacaa cagcaaagta actatccaat gaaagtgtat      1380
     cccacgatac ctgtattaaa gcagccacaa caaggaggag gatatccgaa tcagaatgtg      1440
     atccaaaatc aaactagtgt taatgcagct aatatggcta tgcgtcaaca acagcagcag      1500
     cagaataaaa taaatcagaa caacccacca gccgcattac agccggtgag acaagcacca      1560
     aagaagccag ctggagtatc aaaggatggg gctgaaaaag caaagaagac atctaaacca      1620
     acaatgtcaa acgcagaaat aatgagtaaa ttaaagcagg taacacttga tgccgatcct      1680
     tctacgttat ttaaaatgat tgaaaaggct gggcaaggtg caagtggttc cgtatatcta      1740
     gcagagagaa cagaaattat tgaagctgac ggtcctcaac atcaaagagg aggtactgaa      1800
     cacgaagatc ctctaattgg tgataaggtt gcaataaaac agatggtatt atccaagcaa      1860
     cccagaaaag aattaatagt gaatgaaatt atggtaatga atgattctcg tcacgaaaat      1920
     attgttaact tcttggaagc atatctaaaa actgaagatg acttatgggt tgttatggaa      1980
     tacatggagg gtggctcatt aacagatata atcgaaaaca gtccaacaaa tggcagcgct      2040
     tattctccat tatctgaacc tcagattgca tatattgtaa gagaaacgtg taaaggtctg      2100
     aaatttttgc atgataaaaa tattattcat agagacatca aatcagacaa cgttttactg      2160
     gacaccaaag ctcgtgtgaa gattactgat tttgggttct gtgcaaagct taccgatcaa      2220
     agaagcaaaa gagcaacaat ggttggaact ccttattgga tggctcccga agttgtcaag      2280
     cagaaagagt atgatgctaa ggtggatgtt tggtctttag gtattatggc aattgagatg      2340
     ctggaaggag aaccacctta cttaaatgaa gatcctctaa aagctcttta cttaattgca      2400
     acgaatggta caccaaaatt gaagcacccc cagtccttat cacttgagat taaaagattt      2460
     ttaagtgtct gtctttgtgt tgatgtaaag tatagggctt cgacagagga attgttgcac      2520
     cacagtttct tcaatatagc atgtgagcct gaggacttaa catcactttt ggagaacaag      2580
     aagtaa                                                                 2586
//

If you have problems or comments...

PBIL Back to PBIL home page