(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE17

CAGLA1_12.PE17       Location/Qualifiers
FT   CDS_pept        complement(59097..59723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435644"
FT                   /locus_tag="CAGL0M00484g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAG62342.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG327482"
FT                   /db_xref="HOGENOM:HBG507301"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI00003B6FF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK78"
FT                   /transl_table=1
FT                   /translation="MSEEKIYISYNNIHKLCQKIAKQILEREERPDVIIAITGGGMIPA
FT                   RIIRSFLKVQGQKNIPIQAIGLSLYEDLGLGNTADVIGKEVIRTQWLDFGALDQHFDSL
FT                   IGKKVLIVDEVDDTRTTLHYAVTELQKEVEEQQKRLNRLNEDTIFSIFVLHNKDKKKRA
FT                   QLPAEMMDSGRYLAALTVPDKWLCYPWEAQDIEEHTILAKQQGND"
     atgtctgaag aaaagatcta tatttcttac aacaatatcc acaagctttg ccaaaaaatc        60
     gctaagcaaa ttttggaaag agaagaaagg cctgatgtta ttattgctat cacgggtggt       120
     ggtatgatac ctgctagaat tattagatca ttcttgaaag ttcaaggtca aaagaatata       180
     cctattcaag ccattggttt atctctctac gaagatcttg gattgggtaa caccgctgat       240
     gtaatcggta aggaagtgat tagaactcaa tggttggatt ttggtgctct agaccagcac       300
     ttcgactctt tgataggtaa aaaagtccta attgttgatg aagttgatga cacaaggacc       360
     actttacact atgctgtgac tgaattgcag aaagaagttg aggaacaaca aaaaagatta       420
     aatagattga atgaagatac aatcttttct atatttgtcc ttcataacaa ggataagaag       480
     aaaagagcgc agcttcctgc agaaatgatg gactcaggta gatatttggc tgcattaaca       540
     gttccagaca aatggttatg ttatccatgg gaagcgcagg acattgaaga acacaccata       600
     cttgctaaac aacaaggcaa tgactga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page