(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE174

CAGLA1_12.PE174      Location/Qualifiers
FT   CDS_pept        448125..449054
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000034183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437845"
FT                   /locus_tag="CAGL0M04037g"
FT                   /product="Similar to uniprot|P32453 Saccharomyces
FT                   cerevisiae YNL315c ATP11"
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62498.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="HOGENOM:HBG058597"
FT                   /db_xref="HOGENOM:HBG397660"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="PDB:2P4F"
FT                   /db_xref="UniParc:UPI00003B708B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS2"
FT                   /transl_table=1
FT                   /translation="MLTRSLVPALRRRITVVARQYSIEDRYKEKLLQKAKAEGVESIEE
FT                   LKKRLADQIEEKKKELNKIDPLRELEQHLNAGSRIHTNKEHKTTKMSNKSNEKSGNVLP
FT                   KDKPYKTLDDYLKLDKIKDLSKQEVEFLWRAKWSNRDDSLVAVVPYVKTFQGMYKYAVK
FT                   NPLFVLPLPRENAADGNKADKDSVPVELQYVQWQFAGPNTVHCLITSLAEYKLHQDFAK
FT                   PHTTIQFHLDLANDKDMVLMNGQVESDSNVSLQDAQLLLLNVQRFYGAMGSETSIAKER
FT                   IQLLEDFNKGSQNFDINKLIQLAQSMEN"
     atgcttacta gatccctagt tccagctttg aggaggcgaa ttacggtagt cgctagacag        60
     tatagtatcg aggacaggta caaggagaag ctattgcaga aggccaaggc tgaaggagtt       120
     gagagcatcg aggagttgaa gaagcgacta gcagaccaga tcgaggagaa gaagaaagaa       180
     ctcaacaaga tcgatccctt gcgtgaatta gagcagcatt tgaacgcggg tagtcgtatt       240
     cacaccaata aagagcacaa aaccacaaag atgtctaaca agagcaacga aaagagtggc       300
     aatgtattgc caaaggacaa gccttataag actctggatg actacttgaa attggacaag       360
     atcaaggatt tatctaagca ggaagttgaa ttcttgtgga gagccaagtg gtctaatagg       420
     gatgactccc tagtggcagt ggtgccatac gtcaagactt tccaaggcat gtacaaatat       480
     gcggtcaaga accccttgtt tgtgttgcca ttacctagag aaaatgcagc cgatggcaat       540
     aaagctgaca aggatagcgt accagtggaa ctgcagtatg tccaatggca gtttgctggg       600
     ccaaacactg tgcattgcct gataacctct cttgcggagt acaagttaca ccaggatttt       660
     gccaagccac atactactat ccaattccat ttggatttag ctaacgataa ggatatggtg       720
     ctcatgaatg ggcaagtcga gtcggacagt aacgtctctt tacaagatgc acaacttctg       780
     cttcttaatg tgcaaagatt ctacggggcc atgggttccg agacgagtat agccaaggaa       840
     aggatacaac tactggagga cttcaataag ggttctcaaa actttgatat caataagctt       900
     atccagctcg cccagtcaat ggagaactag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page