(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE175

CAGLA1_12.PE175      Location/Qualifiers
FT   CDS_pept        449398..450450
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437846"
FT                   /locus_tag="CAGL0M04059g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAG62499.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="HOGENOM:HBG411300"
FT                   /db_xref="HOGENOM:HBG693866"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI00003B708C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS1"
FT                   /transl_table=1
FT                   /translation="MTVKVLFLGPEGTYSHQAAIQQFSHLVDYNVVYEAVDSIPSCVDK
FT                   LIEHDNDIEDVDLYSVVPLENSTNGQVVFTYDILRNLMQGSNGTNMRIRENQVVAPITI
FT                   VGEQYVSILHCLISPDPSIGIESLQNYDTLKIYSHPQVWGQVSKYLVELQKRFPNLKLE
FT                   RINCNSTSEAVLQAAEEQSSSQSSGILNLAIASEIAASIYQCYIIQHSINDILGNTTRF
FT                   LVFKKKSNHRRLLAPPSATPQRVSLLTFTIKQDDPGSLVEVLSVLKDFSLNMCSISSRP
FT                   YLLRSEQISQQGENFRRRNWQYIFFIEFYIEQDKEFDKDKFCDRIDALCGDWCHWGRFP
FT                   RDICYYKNTA"
     atgacggtga aagttctttt cctgggtcct gagggtactt actcgcatca ggcagctatc        60
     cagcagttta gtcatctggt tgattataac gtagtgtatg aagctgtgga ttccattcct       120
     tcttgtgtgg ataagttaat cgagcatgac aatgacatag aagacgtcga tctgtattcg       180
     gtggtgccat tggagaactc cacaaatgga caggtagttt ttacttatga cattttaaga       240
     aatcttatgc aaggtagtaa cggcacaaat atgaggattc gagagaatca agtggttgct       300
     ccaattacaa ttgtgggaga gcaatatgtt tcaattctac attgtttgat tagtcctgat       360
     ccgagcatag gcattgagtc attacaaaat tacgatactt taaagatata tagccatccc       420
     caagtgtggg gacaggtatc aaagtatctg gtcgaactac agaaaagatt tccaaacttg       480
     aagctggaga gaataaattg taactcaacc tcggaagcag tcctacaagc agctgaggaa       540
     caatcgtcaa gccaatcttc tggtatttta aacctagcaa ttgcgagtga gatcgctgca       600
     tcgatttacc agtgttatat tattcaacac agcatcaacg atatactggg taataccaca       660
     agatttttgg tattcaaaaa gaaatctaat catagaagat tactggcacc tccttctgcc       720
     acaccacaac gagtgtcttt actgactttc accataaagc aagatgatcc tggttctttg       780
     gtagaggttt tgtctgttct aaaggacttt tctttaaata tgtgctccat aagttcaaga       840
     ccttacttgt tgagatctga acagatatcg caacagggag aaaactttag aaggcggaat       900
     tggcaataca tattctttat cgaattctac atagagcagg ataaagaatt tgataaagac       960
     aaattctgcg atcgtattga tgccttgtgc ggagattggt gccattgggg aagatttcct      1020
     agagatatat gctattataa gaacactgcg tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page