(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE176

CAGLA1_12.PE176      Location/Qualifiers
FT   CDS_pept        complement(450572..451939)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044616"
FT                   /gene_name="PFS2"
FT                   /locus_tag="CAGL0M04081g"
FT                   /product="Polyadenylation factor subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62500.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG268234"
FT                   /db_xref="HOGENOM:HBG736644"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B708D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJS0"
FT                   /transl_table=1
FT                   /translation="MDQSAAVEGVPQKKYLTLRRSVDVSSSYNRLYYLKKHGLSLPPIE
FT                   PETSFTANIMPPDAYKRNDRIVNLPTKFTHLSSNKVKHVIPAIQWSPEGRRLIVATFSG
FT                   EFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDR
FT                   IHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGL
FT                   IVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR
FT                   ASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEK
FT                   CISAIAYNPVGHILATAAKDRTIRFWTRARPVDPNAFDDPTYNNKKMTGWFFGINNDIN
FT                   AVREKSEYGAAPPPASTAFPQQTQYNNNISRVPEIKEPTPTTDKEQRTSILPGLSI"
     atggatcaaa gtgctgctgt ggaaggtgtt cctcagaaga agtatctaac actcaggaga        60
     tcggttgatg tgagttcttc gtataataga ctgtactatt taaagaaaca tgggctctca       120
     ctcccgccta tagaacctga aacttcgttt actgctaata tcatgccacc cgatgcgtac       180
     aagcgtaatg ataggatagt taatctgccg acgaaattta cacatttgag ttccaataag       240
     gttaagcatg ttattccagc aatccaatgg tctcctgagg ggagaagact aattgttgca       300
     actttcagtg gtgaattctc gctttggaat ggttcatctt ttacatttga gactattatg       360
     caggctcatg atacctcagt gacaacaatg aaatattccc atgctggaga ttggatgatt       420
     agtggtgacg cagatggtac aatcaaaata tggcagccta atttcaatat ggtgaaggaa       480
     ttagatcgaa ttcacacaga aggtattaga gacgtggctt ttagtaataa tgattccaag       540
     tttgttactt gttctgatga taatatatta aaaatttgga attttagcaa tggccaacaa       600
     gaaagagtac tatctggaca tcattgggat gtcaggagtt gtgactggca tccagagtta       660
     ggactgatag tatcaggatc aaaagataat ttagttaaac tttgggatcc gagatctggc       720
     cagtgtgtat ctacattact aaaattcaaa catactgtac ttaaaactag atttcaaccg       780
     acaaagggca atttgctggc agctatctcc aaggataagt cttgtagagt atttgatctt       840
     cgtgcaagca tgaacgaatt aatgtgtgtt cgtgatgaag ttgatttcat ggaactggaa       900
     tggagtacta taaacgaatc gatgtttacc gttggatgct atgacggctc tttaaaacat       960
     tttgatctcg gccaagatac ggaaaagccc attcatataa taccgtttgc acatgaaaag      1020
     tgcatatcag caattgcata caatcctgtg ggccatatcc tagccactgc cgccaaggat      1080
     agaaccattc gattttggac aagagcaagg cctgtcgatc caaatgcctt tgatgatcca      1140
     acatataata ataagaaaat gactggttgg ttctttggta tcaataatga tatcaatgct      1200
     gtacgtgaaa agtctgaata cggcgcagct ccgccaccag cgtcaacagc attcccacaa      1260
     caaactcagt acaacaataa catctccaga gtaccagaaa tcaaagaacc gacaccaaca      1320
     actgataagg aacaaaggac ttctattctt ccaggattga gtatataa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page