(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE177

CAGLA1_12.PE177      Location/Qualifiers
FT   CDS_pept        452677..454272
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348987"
FT                   /locus_tag="CAGL0M04103g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62501.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B708E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR9"
FT                   /transl_table=1
FT                   /translation="MEQVTIGVISLDSSPTENYTLNTAETRQSFQLSGKSEVNTIPGEK
FT                   YEELKMKYIRQHTKAVVLCCLISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSA
FT                   KELSNMKRGLYISIFNIGCALGGIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFSNGN
FT                   FILLLASRFVLGVTVGAISVLVPMFVSESAPIKIRGALVVVYQLAITLGILFGNILNYM
FT                   TNKHLSMVDPMNNMAWKIPMLFGYLWAAIVAVGACITPESVHFLAKIRNDYESAKISYS
FT                   IMNNISVFDHETIDYVNNLLVKQDVYNENDLRNHKFEFLYGKPKYGKRLLIGIMVMAFQ
FT                   QLSGINYFFYYGTSLFKSVGIKDTYATAIILSSVNFISTFAGIYLVESLGRRSTLIYGS
FT                   FGMFICMIFYASFGTLSLRKDLLSFVLIIVTCLFISIFAITIGPVSFVVVAELFPTRTR
FT                   SVSMSICSSFNWLVNFAIALATPVIINRIGFLYGFFFAGCLLLATGFEAFFVPETKNKT
FT                   EEEIDYMFQNNLKS"
     atggagcaag tcactatcgg tgttatatca ttagattcat ctcctacaga aaattacacg        60
     ctgaacacag cagaaacaag gcaatcattt cagctctctg gaaagagtga agtaaatacc       120
     ataccgggag aaaaatatga agaactaaag atgaagtaca tacgccagca cactaaagca       180
     gtagtattat gttgtttaat atcatttgga ggaatgatac taggctggga catcggtacc       240
     gtgggtggtg tgtcgataat gccaagtttc aataatgcat tcggtgatca aacgacgatt       300
     gtgtcctctg caaaggaact ctcaaatatg aaaagaggtc tttacatttc catattcaac       360
     attggatgtg ccttaggtgg tattatgttt tctaggttat caaatactgt gggtcgtaga       420
     gtaggaattc taaccgctat agcaaagtat actcttgtcc tgacggtcca gttattctca       480
     aatggaaact ttatccttct tctggcatct agatttgtat tgggagtaac tgttggcgca       540
     ataagtgttt tggtgccgat gtttgtatca gaaagtgcgc caattaaaat tcgaggagca       600
     ttagtggtag tctatcaact agcaataaca ttgggaatac tctttggaaa tatactaaac       660
     tacatgacta acaagcattt gtctatggta gatcccatga acaatatggc atggaaaatt       720
     ccgatgctat tcggttacct ttgggctgcc attgttgcag tgggcgcttg tattaccccg       780
     gaatctgtcc atttcctagc caaaattcgt aatgattatg aaagtgccaa aatatcatat       840
     tcgatcatga acaatatttc agtatttgac catgaaacta tcgattatgt taacaacttg       900
     ctagtaaagc aagatgtgta taatgagaac gaccttagga accataaatt tgagttttta       960
     tatggtaagc caaaatatgg aaaacgccta cttattggca tcatggtgat ggcctttcaa      1020
     caactttctg gtataaacta cttcttctat tatggaacct cattattcaa aagtgttgga      1080
     atcaaagata catacgccac ggctatcata ctttcatcag tcaattttat tagtactttt      1140
     gcaggcatct acttagtgga aagccttgga agaagatcta cactaattta tggctcattt      1200
     ggcatgttca tatgtatgat attttatgcg tcttttggaa ctttaagttt gagaaaggat      1260
     ctattatcat tcgtactgat cattgttaca tgcttattta tctcgatctt cgccataact      1320
     atcggcccag tatcatttgt agttgtagcc gaattgttcc caacaagaac tagatccgtt      1380
     tcaatgtcta tatgctcttc ctttaattgg ctagttaatt tcgccattgc tctggcaaca      1440
     ccagtgataa tcaatagaat aggcttcctt tatgggtttt tctttgcagg ttgtcttcta      1500
     ttagcaactg gatttgaagc attctttgta ccagaaacta aaaataaaac agaagaagaa      1560
     atagactata tgttccaaaa caacttgaaa tcgtga                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page