(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE180

CAGLA1_12.PE180      Location/Qualifiers
FT   CDS_pept        459618..460739
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044617"
FT                   /locus_tag="CAGL0M04169g"
FT                   /product="Similar to uniprot|P17260 Saccharomyces
FT                   cerevisiae YNL322c KRE1 cell wall protein "
FT                   /protein_id="CAG62504.1"
FT                   /db_xref="HOGENOM:HBG124049"
FT                   /db_xref="UniParc:UPI00003B7091"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR6"
FT                   /transl_table=1
FT                   /translation="MRISRLLLIAGVAQAAIVTDFIITTLADGTLSTVTSIYDNAKPKT
FT                   DTDTDTDTDTDTDTNTATGTTKATTTNTNTNTNTNTGTNTGVKLITTSTVVTDAAGVIK
FT                   TVPTVITSGVKQTGTTTGTTTGTTTGTTTGTTGTKKSYVSTITTVDAAGRPVTLTTTIT
FT                   GTNTNTNTNTNTGTANTPYVTTITTTNINGVTVTLTQTVTPTKAAVDPAAANGALTAFV
FT                   VKSKPSDLVGTAPDGRPDPSLVSFTEVPATPVTTVPIDTYITITEGTTRTYTTLRVPTS
FT                   IWVTITNAAGQTVTFQTTYMQRFSSQYLEVASPSSGSIGLGSLQGEVGVVKSVMVMSQS
FT                   ANAAHNNARAGTPVTSICMSLAMAFLTMFTWFM"
     atgaggatct ctaggctgct gctgatagcc ggtgtggctc aggctgctat tgttaccgac        60
     ttcattatca cgacgctcgc tgacggtact ctgtctaccg tgacttccat atatgacaat       120
     gcgaaaccaa agacggacac ggatactgat acagatacag atacggatac ggatacaaac       180
     actgccacgg gtactacgaa ggctacgact acaaacacca acaccaacac caatactaat       240
     acaggcacga acacgggggt gaaactgatc actacaagta ctgttgtcac tgatgccgcc       300
     ggtgtgatca agactgtgcc tacggttatc acctctggtg tgaaacaaac aggtactacc       360
     acaggtacca ccacgggtac caccacgggt accaccacgg gtactactgg cactaagaag       420
     tcttacgtgt ccactataac tactgttgac gctgctggta ggcctgtcac attgactacg       480
     accattactg gtaccaacac aaacactaac accaacacca acactggtac ggcaaacaca       540
     ccttacgtta ccactattac cactactaac atcaacggtg tcaccgtcac tctgacgcag       600
     accgtcacgc caaccaaggc ggctgttgac cctgcagccg caaatggtgc gcttactgcc       660
     ttcgtcgtga agtccaagcc ttctgacttg gttggcactg ctccagacgg aagaccagac       720
     ccatccctgg tgtcgttcac cgaggtgccg gctacgccag tgactaccgt gccaatcgac       780
     acttacatca ccatcacaga aggcaccacc agaacttaca cgaccttgcg tgtccctacc       840
     tctatctggg tcacaatcac caacgccgca ggccaaacag tcactttcca aaccacatac       900
     atgcagagat tctcctcgca atacttggaa gtggcgtccc catcctcggg ctccattggt       960
     ctggggtccc tgcaaggcga agtcggtgtt gtcaagagcg tcatggtgat gtcccagtcc      1020
     gccaacgccg ctcacaataa cgccagagcc ggaacacctg taacctccat ctgtatgtct      1080
     ctagccatgg ctttcttgac tatgttcaca tggtttatgt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page