(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE182

CAGLA1_12.PE182      Location/Qualifiers
FT   CDS_pept        complement(463756..464523)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195774"
FT                   /locus_tag="CAGL0M04213g"
FT                   /product="Similar to uniprot|Q12288 Saccharomyces
FT                   cerevisiae YLR126c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG62506.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG097859"
FT                   /db_xref="HOGENOM:HBG202458"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI00003B7093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR4"
FT                   /transl_table=1
FT                   /translation="MTVAARKVAIFYTDHPNEWSRDDGTFATMAVELLEQAKEHEPYVG
FT                   AEGGIEYRVFDVYNGELPSVDELSSGDYLGLYITGSRYDSFDTETQWIVDLRKLLYRLV
FT                   NETTLPIVGICFGHQVLARSLGAQVGRNPKGLEAGVHGVQLNATGKTLFSRDRLYLSEL
FT                   HSDHVEEVPPGYENWGHTEKSHCQGLYKPQRVLTFQGHPEFTTQLAIKSTQHKHQTGQL
FT                   SDEEYAETIQRCHSNNDGVHAARNIWKLYHGKI"
     atgactgtag ctgctaggaa agtagctatc ttctacaccg accaccccaa cgagtggagc        60
     cgcgacgacg ggacctttgc cactatggcc gttgagctgc tggagcaggc caaggagcac       120
     gagccgtacg tgggggccga gggcggtatc gagtaccggg tgttcgatgt gtacaacggc       180
     gagctaccgt ccgtggatga gctcagcagc ggggactacc tggggctgta catcactggg       240
     tcccgctatg actcctttga cacagagacg cagtggatcg tcgatctgcg caagctgctg       300
     taccggctgg tcaatgagac cacactgccc atcgtgggca tatgcttcgg ccaccaggtc       360
     ctcgcgcgca gtctcggtgc gcaggtgggc cgcaacccga aggggctcga ggccggcgtg       420
     cacggcgtgc agctcaacgc cacaggcaag acattgttct cccgggaccg cctctacctc       480
     agcgaactgc actcagacca cgtagaggag gtcccgccgg gctacgagaa ctggggccac       540
     acggagaaat cccactgcca gggcctctac aagccgcagc gcgtgctgac atttcagggc       600
     caccctgagt tcaccaccca gctggccatc aagagcacac agcacaaaca ccagacgggc       660
     caactctccg acgaagagta cgctgaaaca atccaaagat gtcacagcaa caacgacggc       720
     gtccacgcag caagaaacat atggaaactg taccacggca agatatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page