(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE183

CAGLA1_12.PE183      Location/Qualifiers
FT   CDS_pept        complement(464973..467324)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437847"
FT                   /locus_tag="CAGL0M04235g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAG62507.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG124050"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniParc:UPI00003B7094"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR3"
FT                   /transl_table=1
FT                   /translation="MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNH
FT                   QLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIER
FT                   HVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEI
FT                   VDYFDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSL
FT                   LFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFN
FT                   CVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQR
FT                   KDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMI
FT                   GSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKLDLFDILLELLESKETLVIE
FT                   FKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIY
FT                   KSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRF
FT                   YSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEG
FT                   LTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLE
FT                   ESVVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQ
FT                   KQLQDYLDTLVEEGVLSSASNDSYKLPQIR"
     atgatattaa ctggggatac caagactttc aagagggctg ttttagagta cggcgtcaac        60
     ggcaacaaga atagcaatgc tgaggagtgg aatgtgttgc ttcaatggtt agatccagct       120
     ggtaagaaga atcaccaatt gaagccccca aacttgttag ttaagacaat gatcgagaaa       180
     ttattgctag gaagtaacga ctatcaactt ctaagtaaca ttcaggatta ctactgttgg       240
     caatgcagag tttattttta caatgagtac aaacgaatag agactctcaa tgagttgaaa       300
     agaatagaga ggcacgtttt attcccttta aaatatatac caatttttga aggtaataat       360
     cgagttgaaa atgaagtcag gttgtttggg aactatctat taaaaactaa caagaaggtt       420
     atgtcaaggg cggttgagag actccgaaac cggatgcttg aagatgattt tgaactagct       480
     acggaaattg tagattactt tgattattgc cagactgatt ctactagcat tgtattggat       540
     ataatacttg acaaaattga gcagttttgc caattacact atacaagaaa atggaataaa       600
     aggtacctaa tcatggagac gtttaatcag ttcatatcac aatactggga tcaattgtca       660
     agcttactat tttgccagga ggataatcat accattacaa atacacttta caaatacttt       720
     gagaagcaat ttatctccat tcgaaccaat gaaatatttg atatatgcat aagtaatcct       780
     gcaagtgttc aaccgacgtt attagagttg agaaaggaaa tatccactgt gaacgatttt       840
     aactgtgtag ttgttgaact tttgtcaaag ttcaatttaa aggttatcaa ccctagtatt       900
     gttactgctg acgctttgtt tctttatatt cgtacaatca agacatttag cattttggat       960
     ccttcaggtc gatatttgca aacaatttcc tcatatgtta aacctcattt tagacagcgg      1020
     aaagatctgg tacatttatt attattttca atgcttggtc ttgatgaaac tgatcaactg      1080
     aatacaatgc ctagccaagt cagtgaggaa aaactaactg cattgacaaa cgagttaaag      1140
     gacacagaaa tctgttcata cacagaagaa tcagatgatg tggtagatcc tatgatagga      1200
     tcgttttcca aagaagagga tagtatggtg ctagagcagg taataaagag gtatatggaa      1260
     tggatcccag aagtgccgac atccttcggt aaaggtatcc tttctgatca taaattagac      1320
     ttatttgata ttctattaga actactagaa tcaaaagaga cgcttgttat agagttcaag      1380
     aaccttttga ctaaaaagct actcgattta agaggctaca cattggataa aaagtggagc      1440
     aaattcctaa gcctgctcaa aaaacgtttt gacaatagaa gcacggaaac gatggatgaa      1500
     gaagacctga ataacatcaa taccattgat atcatgctaa gagatattta caagagtagg      1560
     caaattgcta ctgatatgca acttgatttg cataatacca acgtgaaagt gtacccgaag      1620
     atcgtttctg cattatactg gtcaaataat tctgacacac aaagcaaagc tggtgacttt      1680
     gagatggatg gcgaattgga acatctattg gaattatatt cgcgcttcta ttcgcagaaa      1740
     caaatcggcc aaaaattaga actgagaagg gataacggtt ctgtctcttt gaacttaagc      1800
     tttttggatg ggcggaccgt gcactgtaaa gcgtcattgc gtcaatactc ggtactcaca      1860
     ttgttcaaaa gccccaaaca tgactctaat tttcccaccg agggcctcac aatcagtgaa      1920
     ttgtgtgcaa gatcagggat gcaatctaag cagatggccg atattctacg atattgggta      1980
     agcaaagatg tactgtattt ttcggacggt aagtatcgta cattagagtt cctaagatgg      2040
     aaaggtgact ctacatacgc cgctatacca gatgtcctgg aagagtccgt agtagaacgt      2100
     tcttctcaac acgaggacaa gcaagagaac catgtcgaaa gggcattgcc ctacattaaa      2160
     gacatcctct tgaaccttgg taccctcaag atagacaagc ttcacgcttt actacaatca      2220
     gccatgccaa aggactcgca ctatagcacg gtaaaccaga agcagctgca agattacctc      2280
     gacaccctcg tcgaagaagg tgtgctttcc tctgcgagca acgacagtta caagctgcct      2340
     cagataagat ag                                                          2352
//

If you have problems or comments...

PBIL Back to PBIL home page