(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE184

CAGLA1_12.PE184      Location/Qualifiers
FT   CDS_pept        467785..468606
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112177" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437848"
FT                   /gene_name="DCN1"
FT                   /locus_tag="CAGL0M04257g"
FT                   /product="Defective in cullin neddylation protein 1 "
FT                   /protein_id="CAG62508.1"
FT                   /db_xref="HOGENOM:HBG202460"
FT                   /db_xref="HOGENOM:HBG206132"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniParc:UPI00003B7095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJR2"
FT                   /transl_table=1
FT                   /translation="MVSRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYD
FT                   KEVGGFTEDHMIRHQFKYPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLED
FT                   LVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTT
FT                   IYNYSFDLNASKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHK
FT                   KLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNVL"
     atggtttcaa gacatgagaa ggagttaatg aagacgtttc aatcattgac ttcatgcact        60
     gacgagggaa aagccaagag atatttgagt gctaacaatt ggaacatcaa ctatgctttg       120
     aatgaatact atgacaaaga agttggtggt ttcactgagg atcatatgat aagacatcag       180
     tttaagtacc ctgatgagct ggtatcatta tttggacact atgcggcttt aattgaagaa       240
     gatgggactc agagtattac acccgatgga cttatagact atatccaaga cttaggatat       300
     aatttggaag atttggtcac aatctctttg gcacattttt tacagtgtaa aaacctagag       360
     aatcctatta ctgaaaagca gttcttgtat ttctggtaca atgagggctg ttatacgctt       420
     gaacaaatgc gacattatct agaggactgt gaaagaaaac tatgtaacga ttggaagtat       480
     ttcactacaa tatacaacta ttcatttgat ttgaatgcca gtaagcaagg agtggtggaa       540
     acagacatag ctattgagta ctggaaactg ttttttgaag agaacagaac taagttatca       600
     ggaataataa aagttgatca agcacatttg gacctgtggt gtaaatttct ccaggatgaa       660
     cacaagaaac taatccataa agatacatgg cagatgttgt tgttattttt caagaaattt       720
     ccctccttag acgcaatcaa aactgaatac aacgaggcag atgcttggcc ctacaccatt       780
     gatgagtttt acgaatacct agaagagaga aatgtcctct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page