(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE185

CAGLA1_12.PE185      Location/Qualifiers
FT   CDS_pept        469040..471862
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501152"
FT                   /locus_tag="CAGL0M04279g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62509.1"
FT                   /db_xref="HOGENOM:HBG379828"
FT                   /db_xref="HOGENOM:HBG522343"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B7096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR1"
FT                   /transl_table=1
FT                   /translation="MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGG
FT                   LENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK
FT                   IWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK
FT                   DAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSA
FT                   DSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEI
FT                   YRLRKEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQW
FT                   TVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDD
FT                   NKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIAS
FT                   STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPML
FT                   QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSM
FT                   DISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT
FT                   VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER
FT                   EKEMDEQYEDTLLTSLEGGAGDEMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEAL
FT                   EIGVNDIIAMEEFNEQLNAWKKSKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPS
FT                   QIEDALMVMPFSYILKFLKFIDVVTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNA
FT                   NLKLQITRVKDNLRKSLKSNVDELGFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKH
FT                   SKKRVFGTLA"
     atggtgaagt catatcagcg ttttgagcaa gctaatgtgt tcggtgttat atcatccaat        60
     tccaacagtg tttggatcga accagaggct agcaagcgta aaaccggtaa cttaggacaa       120
     gtgattgtgg gaggtttaga aaacatatta gtttgggata tcaagacagg cgaacaaatt       180
     gcccaattaa ctgatggtct tccacccggt gcatctgatg ccaaactgtc aaaacctgct       240
     gaaactacat ttttaaaata tcatccagaa accaatttat tggctgctgg ttacgctgat       300
     ggtgtgatta aaatttggga tttaatatcc aaaactgttt taatttcttt taatggtcat       360
     aaatctgcta ttactgtttt agcttttgac acaactggta ctagattaat ttcggcatcc       420
     aaggattcag atataattgt atgggatttg gtaggtgagt caggtttata caagcttcgt       480
     tcacacaagg atgccataac tggtctgtgg tgtgaagatg aaaactggct cattagtaca       540
     tcaaaggatg gtcttgttaa gatatgggac ttaaaatctc agcaatgtgt agaaactcat       600
     ctagcacata ccggagaatg ttggtccctt ggtattattg aagatatggc cgttacttgc       660
     agtgcggata gtcaagtgaa gctgtggaaa cttgatttac aagctgaaaa tggctccaaa       720
     ttaacagaaa aaggcatcat agaaaaacag agtaagcaaa gaggtgttga aatcgatttt       780
     gctgttgcac cagatggcgt aaaattcttt tatatacaaa atgctgataa gactattgag       840
     atttacaggt taagaaagga agaagaaata tcaagggctt taaagaagag agaaaagcgt       900
     cttcaagaca aaggtatgtc agaggaagag ataaaggaag ccatgggaag tccagtatct       960
     ctgatgtatc atttgttcca ggttgttcgt tcaccataca aaattaagtc agcgcaatgg      1020
     acagtttgtt ccaactcaaa actagagctt gtcgtaacta cgtccaacaa ctcaatcgag      1080
     tattactcaa ttccttactc taaaagagag ccaacacagc ctgctccact aaaacttcac      1140
     actattgatc tacatggtca aagaacggat atcagatcaa caagtataag cgatgataat      1200
     aaattgctgg ctactgcttc taatggttca ttgaagattt ggaatataaa aacgaagcgt      1260
     tgcataaggt cattcgaatg tggatatgcc ttgacatgta aatttctacc aggtggcgca      1320
     ttagttgtgg tcggaactag aaatggtgaa ttgcaattgt ttgacattgc atcttctact      1380
     atgcttgaca ataaggaagg ggcacatgat gctgctatct ggtcattaga tttaactagt      1440
     gatggaagaa agctggttac agggtcagca gataaaactg taagattctg gacctttgag      1500
     gtttcagaag taccagtttc cgatgagtcc aataaaacta tgccaatgtt gcaattattc      1560
     catgatacca ctttagaact agatgacgat attttaagtg tggtgatatc gcctgatgac      1620
     aaattcattg ctgtatcatt actcgataac acagtcaagg tatttttctt ggattcgatg      1680
     aagtttttct tgagcttata tggtcataag ctgcctgtat tatcaatgga tatttcatat      1740
     gattcaaagc taatagttac atgctctgct gataagaata taaaaatttg gggtctagat      1800
     tttggtgatt gtcataagtc attgtttgct catcaagatt ctattatgaa tgttaaattt      1860
     cttcctgagt cttataactt tttcagctgt tccaaagatg ccactgttaa atattgggat      1920
     ggtcagaaat ttgaatgtat tcaaaaactt gcagcacatc aaagtgaagt ttggagtatt      1980
     tcagtttcaa acgatggtac atttgttata tctactggac atgatcacag tataagagta      2040
     tgggaagaaa ctgaggacca agtttttctg gaagaagaga gagagaagga aatggatgag      2100
     caatatgaag ataccctact aactagctta gagggtggtg ctggtgatga aatgttaagt      2160
     gttaagaagg gtgataacga ggaatctgaa gaagttgaag gtgttcataa gcagacagta      2220
     gaatctttaa aggctggtga gagactgatg gaagcgcttg agataggtgt taatgatatt      2280
     attgcaatgg aagaattcaa tgaacagctc aatgcctgga agaagtcgaa aaagggtatt      2340
     caacctatca gaccccagga aaatactctt ttagtagcat taaagaaaac tccagaggaa      2400
     tatataattg aaacattggt taaaattaaa ccttcacaaa ttgaagacgc attaatggtt      2460
     atgcctttct catacatttt gaaatttttg aagttcatag atgttgttac aactaaagca      2520
     gcacttctac aaaagcatat ttccttggtt tgtaaaacat tattctttgt gataagattc      2580
     aactacaagg agttagttgc gcaaaaaaat gcaaatctga aactgcaaat aacaagagtg      2640
     aaagataatc tgaggaaatc tttaaagtcc aatgtcgacg aattggggtt caatatagaa      2700
     ggtatgaagt ttataaaaca gcaatgggag ttaaatcacc atttggaatt taatgatgag      2760
     tacgaggaga agaatttcga agaaaagcac tctaaaaaga gagtttttgg aactttagca      2820
     taa                                                                    2823
//

If you have problems or comments...

PBIL Back to PBIL home page