(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE186

CAGLA1_12.PE186      Location/Qualifiers
FT   CDS_pept        complement(472227..473396)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348988"
FT                   /locus_tag="CAGL0M04301g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62510.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI00003B7097"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR0"
FT                   /transl_table=1
FT                   /translation="MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPI
FT                   LSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFG
FT                   ICLMSLFMLFLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNC
FT                   AGHQDSLQDSKKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKF
FT                   SADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIA
FT                   ETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGIL
FT                   IYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA"
     atgcataatg agctgttggg acgttcggtc gatacctgca gtaccgagaa cgactacaac        60
     ggtgaacaga atctgcgtat attagctgta tttattgtca tgatatcttc aggacttggt       120
     gcttatttcc caattctatc ttctcaatat tcttttatta ggttacccaa ctggtgtttt       180
     tttgttgcta aattctttgg ttcaggagtg atcattgcta ctgcatttat ccatttgtta       240
     caaccagctg cagaagcatt gacagatgat tgcttaggtg gtacattcga agattaccca       300
     tgggcatttg gtatctgttt gatgtcctta ttcatgctat tccttgcaga aatagttgcc       360
     catcattttg tcgataaaaa atttaaccat agtcatgcag aaactgataa tgcaaatgca       420
     ttacccgata ttattctcaa agatattcaa atcagtacgg atgatttgag tgaaggtatg       480
     ctaaactgtg ctggccatca agatagccta caagattcta aaaaaatcga aactggtgta       540
     tctactaatt tgaaaagagt ggatgactct ggatttgaag gacagtacga gtacaagaga       600
     gaatcaactg acgaaacttg gatcgatgaa aatactctga caactggtaa tagtgaacac       660
     aaattctccg cagattacgt tagtaaagtt ttcgtgctgt gtgtactgga atttggtatt       720
     attttccatt ctgtgtttgt tggtttatct cttgctgttg ctggtagtga attcaaagta       780
     ttatttattg ttatcacttt tcatcagatg tttgaaggcc taggtttagg aactcgtatc       840
     gccgaaaccg aatggcctcc ttctaaatgg tatactccat ggattatggc ttttgcattc       900
     acaattacct caccaattgc aatagcaatt ggtattggag tgagacattc ctgggtccca       960
     ggatcacgaa aggcattgat agctaatggg gtatttgact ctatctcttc tggaatttta      1020
     atttacactg ggctaattga attaatggcg catgaattta tcttttctaa ccaatttaaa      1080
     ggagaacatt ccctcagaaa catgttaaca gcatatttta ttatgtgctg cggagccgct      1140
     ttaatggcat tacttggaag gtgggcatag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page