(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE190

CAGLA1_12.PE190      Location/Qualifiers
FT   CDS_pept        481522..483702
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437850"
FT                   /gene_name="SLX4"
FT                   /locus_tag="CAGL0M04389g"
FT                   /product="Structure-specific endonuclease subunit SLX4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62514.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG124053"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI00003B709B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJQ6"
FT                   /transl_table=1
FT                   /translation="MDFERAQKNFDAFVINGETDETPNDELRHESQHSDFDTCGTQVPE
FT                   MNFSDDDNSDCGNNEIDRLAHNATETTDKEGDDSIIVTQERIAENRNNSVIEIEDEDQI
FT                   DLSVVNSKEEDNIFLNTQIQSRLDDHEKDLQQKAVLKSFNFEYVDKDESPNMMGSRYIR
FT                   KKSPKKRNSRKNTEEAIQASKSISKRQNNANSLLQILSGKKSKVNAIIKNQRFKYESKT
FT                   GVLKRASQVSNSTSTTYGKEEWKQIKNVLRTRYSKLENSDDRELENFINYLSEQLEKEP
FT                   NLWTSSQIAISTNENNESYRQDSIGSLLTLSQVMGDKSAILESDDEYPDVRPNGESFFK
FT                   CADDSQQLKDDLNIVSQTNSNTNVSGVESVHGLEGKNLYSMGEKEEVTNKMTDFVSKEV
FT                   EQSQVPLLSIHRRGRNNGSYFIFDSSDEYKTIIEIDSSIRQPMDNSNEPSITNHRRTPV
FT                   FSKSQSILDQECDSIEDISLSQGSFKAVTTLISPVKDGSTAQNSQAMDIPTQFSGIPRL
FT                   LDLKTVPKLPFESFNENSKDYRIIISKKKLLELKQAIKRLANIELTEEHEVLGNIDGQP
FT                   GEELFAVVLSISNNLELLSSPGVDTHTKEKSPSLAELRKDLDKIGLKPVRLKSQIIENL
FT                   ASASQVVTVDESNQKKVGVTSKSEVFEFLTHLVKQEPDLLTRIYCFQPITMNDLINKLR
FT                   NKDSFVDLIDDGTIREWTDKLGICIRSNNLKD"
     atggattttg agcgggctca aaagaacttt gatgcatttg tgattaatgg agaaacagat        60
     gaaacaccca atgatgagtt aaggcatgaa agtcagcatt cagattttga tacctgtggg       120
     acacaggttc ctgaaatgaa cttctctgat gatgataatt ctgattgcgg taataatgag       180
     attgacaggc tcgcacataa tgccacagaa actacagata aggaaggtga tgatagcatt       240
     attgttacac aggaacgaat tgcggaaaac agaaacaatt cggtaataga aatagaagat       300
     gaggaccaaa ttgatctaag tgtggtgaat agtaaggagg aggataatat atttctcaac       360
     actcaaattc aaagtcgatt agatgaccat gagaaggatc ttcaacaaaa ggctgtcttg       420
     aaaagcttca attttgagta tgttgataag gatgagagtc ccaatatgat gggaagtaga       480
     tatataagga aaaaatctcc aaagaagaga aattcaagga aaaatactga agaggctatt       540
     caagctagta agtcgatctc gaaaagacag aataatgcga actcattgtt acagatattg       600
     tcaggaaaga aatctaaagt taatgcaata atcaagaatc aaagattcaa atatgaatca       660
     aaaactggag tattgaaaag ggcatctcag gtatccaatt caacaagtac cacttacgga       720
     aaagaagagt ggaaacaaat aaaaaatgtc ttgagaaccc gatattcaaa actagaaaat       780
     tctgatgata gggaactgga gaattttatt aattaccttt cggagcaact agaaaaagag       840
     cctaatctat ggaccagctc acagattgct atatctacaa atgagaacaa tgagtcatat       900
     aggcaagaca gtataggtag tttattgact ctttctcaag taatgggaga taaatcagct       960
     atactagagt ctgatgatga atatccagat gttagaccaa atggagaaag tttcttcaag      1020
     tgtgctgatg attctcagca attaaaagat gatctcaata ttgtgtctca aacgaattct      1080
     aatacaaatg tatcaggagt ggaatcagtc catggcttag aaggaaagaa tctttacagt      1140
     atgggtgaaa aagaagaggt gacgaataag atgacggact ttgttagtaa agaagttgag      1200
     cagtctcaag tgccactatt aagtattcac cgtcggggcc gaaacaatgg atcttatttt      1260
     atattcgata gttctgatga gtataagact ataatcgaaa tcgatagttc aatcagacag      1320
     cccatggata atagtaatga gccctctatt actaatcatc gtcgaactcc agtattttct      1380
     aaatcccagt ccatactaga tcaggaatgt gactccattg aagatattag cctttctcaa      1440
     ggttcattca aggctgttac cacgctgata tctcctgtta aagacggttc tacggcacaa      1500
     aactcgcaag ctatggatat tccgacacag ttctctggaa ttcctaggtt attggatttg      1560
     aagacagttc caaaattacc tttcgaaagc ttcaacgaga actcaaaaga ttatcgaatc      1620
     attatttcaa aaaaaaagct tcttgagcta aaacaagcta tcaaacgact agctaatatt      1680
     gaattgacag aggaacatga agttcttggc aacattgatg gtcaacccgg tgaggaatta      1740
     tttgctgttg ttctctccat cagcaacaac ttagagttac tgagctcacc gggtgttgat      1800
     acgcatacga aggaaaaatc tccaagctta gccgaactgc ggaaagatct cgataaaatt      1860
     ggacttaagc cagttcggct aaagtcacaa ataatagaaa atctggcgtc agcttcacag      1920
     gttgtaacag ttgatgaaag taaccagaag aaggttggtg ttacatcgaa atcagaagta      1980
     tttgaattct tgacgcatct agtcaagcaa gaacctgatt tattgactag aatatactgt      2040
     tttcaaccaa ttactatgaa cgatcttatt aataaactac ggaataaaga ctcttttgtt      2100
     gacttaatcg atgatggaac tattcgagaa tggacagata aactgggtat ttgtattcgg      2160
     agtaacaatt tgaaagactg a                                                2181
//

If you have problems or comments...

PBIL Back to PBIL home page