(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE193

CAGLA1_12.PE193      Location/Qualifiers
FT   CDS_pept        complement(489048..491183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501155"
FT                   /locus_tag="CAGL0M04455g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62517.1"
FT                   /db_xref="HOGENOM:HBG124054"
FT                   /db_xref="UniParc:UPI00003B709E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ3"
FT                   /transl_table=1
FT                   /translation="MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQ
FT                   KIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGI
FT                   STNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRY
FT                   EQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINEKDDL
FT                   IIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEIS
FT                   LNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEK
FT                   QYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWL
FT                   DKNKLWYRLQLPENKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTR
FT                   QHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQ
FT                   LKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFD
FT                   FKIVSDAVVSLNPSLENDDPGQWLEGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPT
FT                   EEEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRIDLICDDNPDYN
FT                   DFSNFIQQSLEFGKKKI"
     atgctgagag ctttgccatt actgcgaaag cggatactgc cggcgtttag gacgaggata        60
     agactctaca gcgatgattc gctgaaagag aagctattat cgactagggg taagaagaag       120
     atgcctgaga aacaaaagat tgtggtgcta aaccctggac aagttacctc ttttaagaga       180
     aggcgaagag gccctgtaac agatcatgca aatacacata caacaactga tagtttaatt       240
     acacgacata atagaccaat aagtgcccct aggaccaagt tatctatact ggaaggtgtt       300
     gatctcggaa ttagtacaaa tggtagcaaa gaggaagata aagaaaaact gactgacact       360
     gtcttagagg aaatagacca gaaacgtcgg aagttgatgg tattcagaag taccgtatct       420
     gaagaacaag ctgtgaaagc tattggttat caaaagcctg taaaacctat catgtctcaa       480
     aaaagatatg aacagctgga gaatttgctg aaatcagctt acactgtcaa ccaattgagg       540
     gcatattcca agaagatgtt cggcccgtct cttttcaaga agtcaaaggc atttattata       600
     aaaaagatta tgaatgaata ctggcaatgt caggtggatg aaaacataaa tgaaaaagat       660
     gatctaatta tagagcgcga gctggatatc aagactagag atacttacct tcttttgctc       720
     acagacaatg gtaaaatact acataattta gctaggatag gtgcaatttt ggcagtagct       780
     ccagaagaaa acaaaatcat aatcagggca tcggcgaatg ttattaggta tgtggaaatt       840
     tctctcaata gaattttaga gaatgtgaaa actgaaatag tgccaattga aaagttgatt       900
     agagatcatt ctatagacgg taaactggac ggagatatga atgttgaaca aataatcgat       960
     ttggtgcaaa aacaagctag tgtttatatt gatttaatct ccgatagttc tgaagaaaaa      1020
     cagtacaaca tctctgcttt tggaaaaaag agaattgata cagcaaagct atatctgact      1080
     tgggcaagta agtacacgcc acatgtacaa gaagaatata tcaccacagg tgataaatgt      1140
     atgaaggaaa agtgtaagga atatccatac acagacatgg attcgttcaa ttggttagac      1200
     aaaaataaac tgtggtatag attacagttg ccagaaaata aattgttagg caaaactgat      1260
     aaactcgagt atcctcccac aattgaaatg ctggatgtca aaaggattta tgacttccta      1320
     actgataaga atatttcctt gaagcaaaaa ctcttgcctg tgaagggaac taggcaacat      1380
     gtaattagtg ttaccatggg acagcttttg aaagctggaa actcaatgat aagaacattt      1440
     ttaccacgta taccaacaat ttctaatttt ctaatggatc taccatattt tgaagaaaca      1500
     catgaggggg atctatctgt tcttggagaa aacgatgatt attatgttca gttgaaattc      1560
     aaaccagatt tatcatcaat accacccggg attaagagtt atccacctaa catggaatta      1620
     tggtttgaac ttgatgaccg agataatgca attaaggcct cgatggactg tattttctca      1680
     gtttctgaga aggcagttat gttagaagca cctcagcatc cctttgattt caaaattgta      1740
     agtgatgcag tagtttccct caatccgtcg ttggaaaatg acgatccagg acaatggctt      1800
     gaaggacaag atgaattaaa acactatgtt gatcaagcta aattagattt tggtcaaggt      1860
     aacaagatgt tgttaggtaa cagcgtttgt gttaatatcc caacggaaga agagggcacc      1920
     gtgcaagtcc gctatgattt tgtgaacact tatcgacatc gcattacaag gcttaaattt      1980
     cgggacagat ttctggtgca atactcaaac attaacggag gtgctcgtgg tggccagaca      2040
     aatagaattg acttgatatg tgatgataat cctgattaca acgatttctc caattttata      2100
     cagcagtcat tagaatttgg aaaaaaaaag atatga                                2136
//

If you have problems or comments...

PBIL Back to PBIL home page