(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE198

CAGLA1_12.PE198      Location/Qualifiers
FT   CDS_pept        complement(499618..501930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195775"
FT                   /locus_tag="CAGL0M04565g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAG62522.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG059774"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI00003B70A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP8"
FT                   /transl_table=1
FT                   /translation="MSYNRPPMPLPKDANPNRSTSGLFYPNEPIMPPRNEEPDSMISSL
FT                   VLDTATPTIDAMNSINITNDMVQEAEYVTVNDLPINTSAPPAMFTRTGHEIPIPDGVER
FT                   NGRPVATNKFYGNFLLGSQTCATWTHPYSVWISKDNAFPGFAANHVRASQRVFGDGNPA
FT                   PFFFSPIGIRSFVFGANELPSFESMSLRFTDLSHMSIHVWLKKSESEHIRFPIVQGMGF
FT                   ITANYSNLTPRLQSAVGFRNLNSMASPRTDMQKYQVLLENDVKWTIYVKLDSKCNNFQL
FT                   FIANGNTIQANQRVSSATIQVVADTVEAIDQAAGCYPVNCDVVNAVNKDKGIYRLAYKT
FT                   EGYSNKGTTLLYGLRHHMVSMTIPTALTSINSELDSTVMGVMRGFITNTLEMQVQIPAN
FT                   VDFIPATTIPGRRVLYSHEVLEKVRDAARKEVNGDVINESNVNSMYFSGKVLAKYAWIL
FT                   FCCQYIVNDRGLVDILLPKLKEAFARFSQNQQQLPLRYDTTWGGVISSGTSGDDFGNSY
FT                   YNDHHFHYSYHIIAAAILTKVDRDIGNGSWFTENREWVETLIRDYANPSENDPYFPMYR
FT                   SFDWFTGHSWAKGLFESGDGKDEESSSEDVNSCYALKLWGMVSGNVALVNRSNVQLGIL
FT                   NTSLNQYFLYDDANKTEPPQFIGNKVSGILFENKIDHTTYFGNYLQYIQMIHAIPITPM
FT                   SSFIRHPSYVEQEWIQKLQGIVNDVNDGWKGIMMLNLALFNPRASFEFFSSPNFSGNFL
FT                   DNGQSLTWSLAYSGAFI"
     atgtcataca accgccctcc catgccttta ccgaaggatg cgaaccccaa tcggtccact        60
     tctgggttgt tttaccctaa tgagcccata atgcctccta gaaatgaaga accggactct       120
     atgatatcat cattagttct cgataccgcc actcctacaa tagatgccat gaacagcatc       180
     aatattacca atgatatggt tcaagaggct gagtatgtca ccgttaatga tcttccaata       240
     aacactagtg ccccacctgc catgttcaca agaactgggc acgagatacc tatccccgat       300
     ggtgtggaga ggaatggaag acctgttgct accaacaaat tctatggaaa ctttttgcta       360
     ggtagtcaaa catgcgcaac atggactcac ccttactcag tctggatttc caaggataat       420
     gcgttcccag gatttgccgc aaatcatgta cgtgcttcac aaagagtatt tggtgatggc       480
     aatccagcac cattcttctt tagtccaatt ggaattagat catttgtctt tggtgcgaat       540
     gagttaccat cttttgaaag tatgtctttg cgttttactg acttatcgca catgtcaatc       600
     catgtatggc taaagaaatc cgagtcggag catatcagat ttcctatcgt tcaaggtatg       660
     ggctttatta ccgctaacta tagcaatctg acacccagat tacaatctgc tgtcggcttt       720
     agaaatctga acagtatggc atcacccagg acagatatgc aaaagtatca agtcttactg       780
     gaaaacgatg tgaaatggac catttacgtg aaactagatt caaaatgcaa caacttccag       840
     ttattcattg cgaatggaaa tacaatccaa gctaaccaac gtgtcagttc ggccacaatc       900
     caagttgttg cagatactgt tgaggctata gaccaggcag ctggttgtta tccggtgaat       960
     tgcgatgttg taaatgcagt taataaggac aaaggtatct atagactggc ttataaaaca      1020
     gaaggctatt caaacaaagg tacgaccctc ttgtatggat tgagacacca tatggtatca      1080
     atgactatcc caactgcgtt gaccagtatt aattcagagt tagactctac tgtgatgggt      1140
     gttatgaggg gcttcatcac aaatacgctg gaaatgcagg ttcagattcc agctaatgtt      1200
     gattttatcc cagctacaac aattccagga aggagagttt tatactcgca tgaagtgttg      1260
     gaaaaagtaa gagatgcagc tagaaaagaa gtgaatggag acgtaatcaa tgaatctaat      1320
     gttaactcaa tgtatttttc aggtaaagta ttggccaaat atgcatggat actattttgc      1380
     tgtcaatata tcgttaatga cagaggattg gtggatattc tattaccaaa gttgaaggaa      1440
     gcatttgcac gcttttcaca aaaccagcaa caattaccgc taagatatga cactacatgg      1500
     ggtggtgtta tatcttcagg aactagtggt gacgattttg gaaattctta ctataacgat      1560
     catcatttcc attattccta ccatattatt gccgctgcaa ttttgacgaa agttgacaga      1620
     gacattggta atggtagctg gtttactgaa aatcgagaat gggttgaaac cctaataagg      1680
     gattatgcta atccttcaga aaacgatccc tatttcccca tgtataggtc atttgactgg      1740
     ttcactggac actcgtgggc aaaaggtctc tttgagagtg gtgatggtaa agatgaagag      1800
     tcaagttctg aagatgtcaa ttcttgttac gctttgaaac tatggggtat ggtttctgga      1860
     aatgttgcat tggtcaacag atcgaatgtc caacttggaa ttctaaacac atcacttaat      1920
     caatatttcc tttatgatga tgctaacaaa actgaaccac cacaatttat tggtaataaa      1980
     gtaagtggta tattatttga gaacaagatt gatcatacaa cttattttgg gaattatctt      2040
     caatacatcc aaatgattca tgctatacca ataactccca tgtcgtcatt tatcagacac      2100
     ccatcatatg ttgagcaaga gtggattcaa aaacttcaag gcatagttaa tgatgttaat      2160
     gacggttgga aaggaataat gatgctaaat ttggctttgt tcaatcctcg agcatcattt      2220
     gaattttttt catctcccaa tttctccggt aatttccttg ataatggtca gagtttgaca      2280
     tggtcccttg cttattcagg tgcgttcatt tga                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page