(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE2

CAGLA1_12.PE2        Location/Qualifiers
FT   CDS_pept        22039..23691
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435638"
FT                   /locus_tag="CAGL0M00154g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62327.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6FE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK93"
FT                   /transl_table=1
FT                   /translation="MSSSISDREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIRED
FT                   LTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGE
FT                   MSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHH
FT                   FPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHE
FT                   YIGFKNWTHGEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTV
FT                   FWRILIFYVLSTFFIGMNIPYDYPGLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTS
FT                   VISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFI
FT                   GAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKTDLLQFKNWTYPFGPYFLV
FT                   IFTVFIILIQGWQAFDPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVKYEDMDFVTD
FT                   RYIPTKEIVELNERLDNLKGWKKVRQIFSDYIA"
     atgagttcgt ctatatcaga ccgggaggct gttaaagtcg actctggcaa gcaagaaata        60
     tatgaagtga gcagctcgct agacatcgat gagttgaggt ctgattttga tccggagcaa       120
     aatattcgtg aagatttgac cagagcatta agtcccaggc acattaacat gatatctatt       180
     gcaggcatta tcgggacagg tctatattta tctactgcga agtccttgca taatggtggt       240
     ccagcttcgt tgtttatgaa ttatacaatt ataggtggtg tagtatattt gactatgtta       300
     tgtctggggg aaatgtcgac attcatgcct atcagcggtt cgttttgttc atatgcacgc       360
     aaatttggct cagaatcctt cgcatgtgca ttgatgtgga attattggtt taatgacgct       420
     gtctctgtgg caagtgactt aactgcatta cagctggtct tggattactg gcataccgct       480
     gatcaccatt tcccatactg gggtgcttcc cttatattct ggttttttgt cttattctta       540
     aacgttatcc atgttagaat ttatggggaa gcagaatatt ggttagctat gttaaaagtt       600
     attgccattg ttatcttttt cattatgtct attattgtga acgttggtaa gaatccccaa       660
     catgagtaca ttggtttcaa gaattggaca catggcgagg ctccttttgt taatggtttc       720
     aagggttttg catcattatt tgttagcgcc tgttttgctt atggtggtac tgaatcaatc       780
     actttaactg gtggtgaagc tagtaatcct gttagaaata cgccaaagat tgtaaaaact       840
     gtcttctgga gaatattgat attctacgtt ttatccacat ttttcattgg tatgaatatt       900
     ccatatgact acccaggttt atctactaaa tctgtcatga cttctccttt tactcttgtg       960
     ttccaaatgg caggtactcg tggggctggt tcctttatga acgctgtcat tttaacaagt      1020
     gttattagcg catgtaatca tgcactattt gcaggtagta gaattatgta caacatggct      1080
     ttggatgggt acttgccaaa gaaaattgtt ggacgtacta atagatataa ggcgccatat      1140
     gttgctgtgt tgatcacttg ggctgtcggt ggtttgtgcc tgggtgccag ttttataggt      1200
     gcgggtactc tatggacctg gttacaaaac attgttggtg tttcaaacca aattgcatgg      1260
     ttatgtattg gtattacatc aatcagattc agaaaaggtc ttgaagttca aggaaaaacc      1320
     gacttactgc agttcaagaa ctggacatat ccctttggtc cttatttcct tgtaattttc      1380
     actgttttca tcatccttat tcaaggttgg caagcatttg atccatggag cgttacagat      1440
     tttttctctg tttatttgga gctcttcgtt tttccatttg tctatattat atggtggtta      1500
     tggaagagag attggtttgt taagtatgaa gatatggact ttgtgactga tagatatatc      1560
     ccaaccaagg aaattgtgga acttaacgaa agactagaca acctaaaagg ttggaagaag      1620
     gtgagacaaa tctttagtga ctacatcgcc taa                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page