(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE20

CAGLA1_12.PE20       Location/Qualifiers
FT   CDS_pept        66078..67787
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436684"
FT                   /locus_tag="CAGL0M00550g"
FT                   /product="Similar to uniprot|P47164 Saccharomyces
FT                   cerevisiae YJR130c STR2"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG62345.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG262693"
FT                   /db_xref="HOGENOM:HBG634482"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6FF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK75"
FT                   /transl_table=1
FT                   /translation="MISEILGESIPKNTEHAVSVCLPLWADVVGYEEGDARVLDSLTTG
FT                   YPRFFIHASVKRLCNLISEQYARAGESCLCFPSYLVAKRCREYITVKSKQLDKDADIGK
FT                   IRILQLAMPQDDTDHTGIFDCKIAALFFKSELFPLAKQYWQHSGEIVSSRLADYVTERL
FT                   YPNAIHIDEATKDNKTFIETRFGRNLDSSFINRAKDILRNRIAHKVVETDHNQDVATNV
FT                   FLFPSGMASIFTAHRLLLNYDHIRVSNIKHNGVDKSDDIIGYGEPYLKTVMFGFPYTDT
FT                   LSILKKFNHTYFLGLGDESAMKDLIGILESGEQILAVFLEAPSNPLLKMCDMSKLKQLS
FT                   QQYGFFIVVDETVSGFVNIDILSYCDIVCSSLTKIFSGDSNVIAGSLVVNPASKLHDFA
FT                   IDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKINKIAEDLVSTVLLEEEGQLLEKI
FT                   YYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKREDQAKVFYDNLSLNKGPSLGTNFTL
FT                   VCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLETLQTIFRKAFDAAKDV"
     atgatttcag agatattggg tgagtctata ccgaaaaaca ctgagcatgc agtgtctgtg        60
     tgtctacctt tatgggcaga tgtggttggt tatgaagaag gtgacgcgcg agtacttgac       120
     agcctaacga cgggatatcc aaggttcttc atccatgcgt ctgtgaagag actttgtaac       180
     ttgatcagtg aacaatatgc tagggctgga gagtcctgtt tgtgcttccc atcttacttg       240
     gttgccaaga gatgtagaga atacattact gtcaagagca aacagctaga caaggatgcc       300
     gacataggta agatcagaat tttacagtta gcgatgcccc aggatgatac agatcacacc       360
     gggatatttg attgcaagat cgcagctctc ttcttcaaat ctgagttatt cccattagca       420
     aagcaatact ggcaacatag cggtgagatt gtatctagta gactggctga ctacgttact       480
     gagaggttat accctaatgc aatccacatt gatgaagcta caaaggataa caaaaccttc       540
     attgaaacac ggtttggtag aaaccttgac tcctctttca ttaatagagc gaaggatata       600
     ctgagaaata gaattgcaca caaggtagtc gagacagatc acaaccagga tgtagcaacc       660
     aatgtgtttt tatttcccag tggtatggct tcgatcttta ctgctcatag gctcttactg       720
     aattacgatc atattagggt gtctaacatt aagcataatg gtgttgataa atctgatgat       780
     attatcggtt atggtgaacc ctatttaaaa actgttatgt tcggtttccc atatacggat       840
     acattgtcaa tccttaagaa gtttaatcat acgtattttt tgggtttagg ggatgagtct       900
     gcaatgaaag atttgattgg aattcttgaa tctggtgagc aaatattggc agtatttcta       960
     gaagctccat ctaacccatt gttgaagatg tgtgatatga gtaaactgaa gcaattatca      1020
     cagcaatatg ggttcttcat tgtagtagac gagactgtca gcggttttgt taatattgat      1080
     attctatcct attgtgatat tgtctgcagc tcattgacca aaatatttag cggagactca      1140
     aatgtcattg ctggatccct agtggtgaac ccagctagta aactacatga ttttgccatc      1200
     gatttcttaa atgatccaaa gaggaatgag gacctactat ggtgcgaaga ctctgtatac      1260
     ctagaaagaa actcgagaga tttcatcgac agagcacaga agattaataa aattgcagag      1320
     gatctggtat ctactgtatt attagaagag gagggacaat tattagagaa aatatattac      1380
     ccaagcttaa cgagtcccga gtccaaactt aattacgata gtgtcaaatg taacaatggt      1440
     ggatatggtg gattgatttc aatcgtcttc aaacgggagg accaagctaa ggtgttctat      1500
     gacaatctat ccttgaataa agggccatcc ttggggacaa attttacttt agtttgtcct      1560
     tacgcaatcc ttgcacacta tgcagagctc gatgaagttg ctaagtatgg tgtagtcaaa      1620
     aatttggtta gaatatcggt ggggctagaa tctctagaaa ctctccaaac tatatttaga      1680
     aaggcatttg atgccgctaa agacgtataa                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page