(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE200

CAGLA1_12.PE200      Location/Qualifiers
FT   CDS_pept        complement(503641..504537)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000256147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437856"
FT                   /locus_tag="CAGL0M04609g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="CAG62524.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG011091"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI00003B70A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP6"
FT                   /transl_table=1
FT                   /translation="MAEQKYIKDGWFYEMSDEHFPGQALALKVKQVLYQSKSEFQDILV
FT                   FESTNHGVCLVLDGIIQCSERDEFAYQEMIAHIPLYCHANPKKVLVIGGGDGGVVREVV
FT                   KHDKVESVTMVEIDKTVIELAKKYLPGMSCAMDHPKLKLNLCDGFKFLKEASMLSNDDK
FT                   YDVIITDSSDPDGPAEAFFQKEYFELLQNALKPDGIVIAQASENVWLDINYLASLRKTA
FT                   NEVFTNTMISYTTVPTYTSGQLGLIVCTNSNDYDLTTPQRQPSVSEQNQLRYYNSQIHS
FT                   ASFVLPNWADMLIYDKK"
     atggcagaac agaaatatat taaggatggg tggttctatg agatgagcga tgagcatttc        60
     cccggacaag cgttggcttt gaaagttaag caagtgttat accagtccaa gagtgagttt       120
     caagatatct tggtgtttga gagtacaaat catggagttt gtcttgtgtt agatgggatt       180
     atccagtgct cggagaggga tgaatttgcc taccaggaaa tgatagccca tatcccattg       240
     tattgccatg cgaatcctaa gaaagttttg gtcattggtg gaggtgatgg tggtgttgtc       300
     agagaggtag tcaagcatga caaggtagag tctgttacaa tggtggagat tgacaagaca       360
     gttattgagt tggccaaaaa atatttacct ggaatgtcct gtgcaatgga ccacccaaag       420
     ctgaagttga atttatgcga tgggtttaag tttcttaagg aagcatctat gttatctaat       480
     gatgacaaat atgatgttat catcactgac agctcagatc cagatggacc tgctgaggca       540
     tttttccaga aggagtattt tgaattattg caaaatgcat taaaaccaga tggcattgtc       600
     attgcacagg catcagagaa tgtttggtta gacattaatt acttggctag ccttagaaaa       660
     actgccaacg aggtgtttac aaatacgatg atatcgtaca ctaccgttcc aacttatacg       720
     tcaggccagt taggtttgat tgtatgtact aattctaatg attacgattt gacaactcca       780
     caaagacaac cttcagtatc agagcaaaat caattaagat attataatag ccagatacat       840
     tcagcatcat tcgttctacc aaactgggct gacatgctta tctatgataa gaaatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page