(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE202

CAGLA1_12.PE202      Location/Qualifiers
FT   CDS_pept        505982..508861
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437858"
FT                   /locus_tag="CAGL0M04653g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62526.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059805"
FT                   /db_xref="HOGENOM:HBG202471"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI00003B70A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP4"
FT                   /transl_table=1
FT                   /translation="MEVEIEHVELGFINELNKNICGLQVEGNLMCFALRTGSLFLIDLD
FT                   TPSNVIRCQIPLVRDGGVNAEKVLKIWLNPSRSLILVKTNFAKYYLCDVDVIVKTNGES
FT                   MTQNAIASVKQLSKKNCDVRSVAWVRNAKATGMHDKFNLLIGTARGQVYYIEINSKLSE
FT                   QNATLLYESPDSIDGIYWNDANGDIIIASKNKLIYWDGLQSSSNNNKNDREISPKITLS
FT                   KKRKSNEVEEYEHMHMEYTNKFAVYKNSFAWVTESGIVFSNVEQVKKSNKKVLGSSKVI
FT                   LNVELPNSKKPIRDIILSDYHILILRESSITIVNQLDNSVIYNQSIWSNDNEHILGFAS
FT                   DVHYKQATFWCFSASNIFEIILKKESNSVWRLLCDQQRYDDALNLQDLSLFEQSSIQYL
FT                   KGMHLLEENVYSDAAKCFGKSDTVSIPEIALKLLDGDDGMLKIGEQKLNALQFFLSEKL
FT                   LNYRHKDSLKYTIILDWIMWNYVRLFCLIDEKACSEREPDRLKYWDQRKEEISASVKKL
FT                   IDDNINLLERGTFYQLLEKSGRRIELLYLAEKLNDHQYLMNYWIRNENWYESLKVLQKA
FT                   KDPQLAYKHANILLVNCSQSTINTWMTMENLNPVFLIDAILTYFSIYQKSTKGSKVLQE
FT                   NYALTYLKWYVGNNDVNDKIIYNTIVYMMITTPIIQEGNDAMQTDHNNDNDVIEFMENY
FT                   SSKSHLEFVLRLSLKFERIKVAIYLLKLSDQYEDAVDLALSNGLVDEAKEIANMESLAK
FT                   DFTIKRKHWIKIAQVVLSQHLEKPDIKQNIRSIIRESEGTVKINDLLPFFNEFTTVANL
FT                   KDELVRSLEEHNHEIITIRDKIKHSLELKKDIIHETEKFKERYRILEPGKSCDQCQKML
FT                   QTRKFLVFPCGHCFHTDCLIRAILSSNDYNLKGKIENFQKRLNKDRKSVNPKELEELMA
FT                   TKCCLCSDIAINKIDEATIDDKERSQWVI"
     atggaagtcg agatcgagca tgttgagctc gggttcatca atgagctgaa caagaacata        60
     tgtgggctgc aagttgaggg caatctgatg tgctttgcgc tgcggactgg ttcgctgttt       120
     ctcattgacc tcgatactcc ttcaaatgtg atacgatgtc agataccgct ggttcgggat       180
     ggcggcgtta acgctgagaa agtgcttaag atatggctca atccttcccg gagtttgatt       240
     ctggtaaaga ccaattttgc caaatactac ctctgtgatg tggatgtaat tgtaaagaca       300
     aatggtgaaa gtatgactca gaatgctatt gctagtgtga aacagctaag caagaaaaac       360
     tgtgacgtta gatctgttgc atgggttcgc aatgctaagg caactggtat gcacgataag       420
     tttaatctgc ttataggaac agctcgagga caagtttact acatagagat caactccaaa       480
     ttatcagaac agaatgctac attgctatat gaatcccctg actcaataga tggtatatat       540
     tggaatgatg caaacggtga tataattata gcatcaaaga ataaactcat ctactgggat       600
     ggtcttcaaa gttccagcaa caacaacaaa aacgatcgag agattagtcc caaaataaca       660
     ctatcgaaga agcgcaaatc gaacgaagta gaagagtatg aacacatgca tatggaatac       720
     acaaataagt ttgccgtata taaaaattca tttgcttggg taacggaaag tggcatagtg       780
     ttttctaatg tagagcaagt caagaaatcg aataagaaag tcctgggttc atcaaaggtt       840
     atcctcaatg tagagcttcc taattcaaag aaacctatca gggatataat actttctgac       900
     tatcatatct tgatcttaag agaatcatcc attacaatag taaatcaatt ggataacagt       960
     gttatttata accaatcgat atggagtaat gataatgagc atatattagg atttgcatct      1020
     gacgtacact ataaacaggc cacattttgg tgtttctcag cctcaaatat tttcgaaatt      1080
     atattgaaga aagaatctaa ttccgtgtgg agattgttat gtgatcaaca gagatatgat      1140
     gatgccctca atcttcaaga tttatcattg tttgaacaaa gttcaattca atatctaaag      1200
     gggatgcact tgctggaaga aaatgtttac tctgatgctg caaagtgttt tggcaaatct      1260
     gatacggttt ccattcctga aatagcatta aaattattag atggtgatga tggcatgttg      1320
     aaaatcgggg agcagaagct aaatgcattg cagttttttc taagtgaaaa actactgaat      1380
     taccgtcata aggactcctt aaaatacaca ataatacttg attggattat gtggaactat      1440
     gttagattat tttgtttgat agacgagaaa gcttgttcag aaagggaacc agatagacta      1500
     aaatattggg accaaaggaa agaagaaatt tcagccagcg taaagaaact cattgatgat      1560
     aatattaacc ttttggaaag agggactttt tatcaactgt tggaaaagtc aggtaggaga      1620
     atagaactgc tttacttggc tgagaaacta aatgatcatc aatatttgat gaattactgg      1680
     attagaaatg aaaattggta cgaatctttg aaagttcttc aaaaggcaaa agatcctcaa      1740
     ttggcttaca agcacgcaaa tatactttta gtcaactgtt cacagtctac tataaataca      1800
     tggatgacta tggagaatct aaacccagtc tttcttatag atgcaatact gacttatttt      1860
     tcaatttacc agaaatccac aaaagggtca aaagtcttac aagaaaatta cgctttgaca      1920
     tatttgaaat ggtatgttgg taataatgac gtgaatgaca agatcattta caacacaata      1980
     gtatatatga tgataacaac gcccataatc caagagggaa atgacgctat gcaaactgat      2040
     cataataatg ataatgacgt gatagaattc atggaaaact acagtagtaa gtctcatctg      2100
     gagtttgtcc tcagattgag cttgaagttt gagagaataa aagtagcaat atatttattg      2160
     aaattatcag atcagtatga agatgcagta gatttagcat tatcaaatgg attagtagat      2220
     gaagcaaagg aaattgccaa tatggaatct cttgccaagg acttcacaat caaaagaaaa      2280
     cattggataa aaattgcaca agttgtacta tctcaacact tagagaagcc ggatataaag      2340
     cagaacatca ggagtattat aagagaatca gaaggtactg tcaagataaa tgatttgttg      2400
     ccgtttttca atgaatttac tacggtggct aatctgaaag atgagcttgt ccggagtcta      2460
     gaagagcaca accatgaaat tattacaatt cgcgataaga ttaagcactc gttagagctt      2520
     aagaaggaca ttatccatga gacagaaaag tttaaggaga ggtatagaat attagaacct      2580
     ggtaaatctt gtgatcaatg tcaaaaaatg ctacaaacac gtaagttctt ggtatttcca      2640
     tgtggtcatt gtttccacac agactgtcta ataagagcca ttctaagctc aaacgactac      2700
     aatttgaaag gaaaaattga aaatttccag aagagattga ataaagaccg taaatctgtg      2760
     aatccaaagg aattagaaga actaatggca accaaatgct gtttatgtag tgacattgcc      2820
     atcaacaaga tagatgaggc aacaatagat gacaaggaac gctctcaatg ggttatatag      2880
//

If you have problems or comments...

PBIL Back to PBIL home page