(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE205

CAGLA1_12.PE205      Location/Qualifiers
FT   CDS_pept        complement(510921..511862)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195776"
FT                   /gene_name="RRP36"
FT                   /locus_tag="CAGL0M04719g"
FT                   /product="rRNA biogenesis protein RRP36 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG62529.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG351277"
FT                   /db_xref="HOGENOM:HBG398117"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniParc:UPI00003B70AA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJP1"
FT                   /transl_table=1
FT                   /translation="MSYYFKNIKPSYDDDSDEVSDEQDLDAILASKMRGRAESDDESSE
FT                   EEDDGLSKLSFGSLKKAEDQLEEEERGELRKKRKPQHSKPINDEPEVRHKVYKEEEQEE
FT                   SDSESGSDDGAFFEEDERDNHSRPKNKNSKKRKHAPTEHSSKKRVSKIRDIPGLEIARQ
FT                   AKSGIYQDVRFTKATGEATDFSVIRRRYKFLDEYREKEIEEMERLLNDKKFVNKAESRE
FT                   IENMKEKVRSMKSRLQSVKNRELEQQIVKDYEGKLNEGNKNRFHLKKAEKRKVIQKWKF
FT                   DHMKAKQREKVMERKRKKKLGKEFKQFEFHNR"
     atgtcatact attttaagaa tatcaaaccc agttatgatg atgacagcga tgaagtttcc        60
     gatgagcaag acttagatgc cattctggcg agcaagatga gaggtagggc cgagagtgat       120
     gatgagagta gcgaagaaga agatgatggg ttgagcaaac tttcttttgg ttcattgaag       180
     aaggctgaag atcagctaga agaagaggaa cgcggtgaac tgcgaaagaa acgcaagccg       240
     caacacagca agcctataaa tgatgaacct gaggtaaggc acaaggttta taaagaggaa       300
     gaacaagagg aatcagacag tgaatcgggg tccgatgatg gtgcattctt tgaagaagat       360
     gaaagagata atcatagcag gccaaaaaat aagaatagta aaaagcggaa gcatgctcca       420
     acggaacact catctaagaa acgtgtttca aagatacgag acatacctgg cttagaaatt       480
     gctaggcaag ccaaatcagg tatatatcag gatgttaggt tcacaaaagc tactggtgaa       540
     gctacagact tctcagttat tagaagaaga tataaatttc tggatgagta tagagagaaa       600
     gagattgaag agatggagag attattgaat gataagaagt ttgtaaataa agctgagagc       660
     agagaaattg aaaacatgaa ggaaaaagta cgtagtatga aatctcgctt acaatctgtc       720
     aagaacagag aactcgagca acagattgtc aaagattatg aaggtaagct gaatgaaggt       780
     aataagaaca gattccactt gaagaaagca gagaaacgta aggttattca aaaatggaaa       840
     tttgatcaca tgaaggctaa gcaacgtgag aaggtcatgg agagaaagag gaagaagaag       900
     cttggtaaag agtttaagca atttgagttt cataatcgct aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page