(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE206

CAGLA1_12.PE206      Location/Qualifiers
FT   CDS_pept        complement(512229..513143)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437860"
FT                   /locus_tag="CAGL0M04741g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62530.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG059632"
FT                   /db_xref="HOGENOM:HBG397428"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00003B70AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP0"
FT                   /transl_table=1
FT                   /translation="MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTN
FT                   YTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQVAAVNCDKASNKQLCGEYGVEGFPT
FT                   LKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLVNSQ
FT                   SSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESAEIIG
FT                   PLVDRIGKLSAGKDKSLLVLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKEGPYSK
FT                   RDDYLAKLKLNKKKKTQVQNDEL"
     atgaaagtgt acctgttaac actgctggtg tatattgctt cagtttttgc tcaggatcaa        60
     agtttttaca aagatgatcc taatatcatt gaactgaccc cttctaattt tgatcgggtg       120
     gtccacaaca ccaattatac tacactagtt gagttctatg ctccttggtg tggttactgc       180
     aagcaattga agaacactat acatagcctt gggaaagcat ctgacagcat tttccaagtg       240
     gctgcagtga attgtgacaa agctagtaat aaacagctat gtggtgaata cggtgttgaa       300
     gggttcccca ctttgaaagt gtttaagcct ggtaaagctg gcaaaactgc agttaagaaa       360
     catgcaagcg agacctatat gggtgagagg aaacttgcac cgctgataaa ttttatcaaa       420
     gccaagatca agaaccatgt gaagaagtta accagtgctg atatggtgag taaattggtc       480
     aattctcaat ctagtaataa atacgctgtc gttttgtttt cgaagcaaag cagtattcct       540
     gtaacttaca agtcaattgc aattgattgg ctggacagag ttaagtttta ttgctacttg       600
     aacacaaaga agaccctagt ggaatctcta aagtctttcg aaagtgaatc cgctgagatt       660
     attggaccct tggttgatcg catcggcaag ttatccgctg gtaaggataa aagcctgctt       720
     gttttaatcg acaaagaaaa ccagaaaatc agtgtgctgg aggataagat aaccaaatcc       780
     aatgttgcca agtttataat agacaacact tctctgaaac caaaggaagg cccatacagt       840
     aagcgagatg actatttagc caagttgaaa ctgaacaaga agaagaaaac ccaggtccaa       900
     aacgatgaat tgtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page