(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE208

CAGLA1_12.PE208      Location/Qualifiers
FT   CDS_pept        complement(514847..520039)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437862"
FT                   /locus_tag="CAGL0M04807g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62532.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG436481"
FT                   /db_xref="HOGENOM:HBG720361"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014978"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00003B70AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN8"
FT                   /transl_table=1
FT                   /translation="MDVPMPQRQLTKEEINRCYLKWQQLRNEHGKNAANVPEFIHLTKI
FT                   LHVAAKQQQEQKQKLQQQQQQQQQQQQVHVGTPQNDNKNNSEPWRVDNPNGSTFSHNKE
FT                   QLETSTDQRPPNFTMNGTEGSASSASPATNPQVQFYKKENSNNGASQRDNFQSRTISDN
FT                   SNSPATSPKSQVVTQNMPVRNNSQPNKSINSPHTINKPNDRQTQPAPLNPTQQRPVPQN
FT                   SIFTPQQSELLRAQISALKSLVNNQPVPQEYQKVIQQSINNPPDFKRMLLSLSDFVKKK
FT                   QLNQQSGSPASEIPEPQPQAQPPVQPPTEPQVQPQATPQAQSQPHAQSQQQDKNSTSDN
FT                   AKIDTNTASANTSMTEEKPIIKTGTNTPNVTHEQIPPVGVQGTSSNTLREETHKTDTPS
FT                   PRTIPGSVTHQIATPNLNKQENQNPETQNQYALKPPTERVPDPLVDGELKPAQQLPPVP
FT                   IQKFVEKYPYVKNVVSIEDPDLMVDTFSIPTIPEEPVDYYSLFPNTANPKLVMEPGMLP
FT                   AGVDIHTATDIYQTLIALNLDTSVNECISDMLDDSKDENTKEETLYDYFALQLLPLQKA
FT                   VRGHVLQYEWYQNSLLTNAHPNFLSKIRNINFNDVLLTIELYRKREVIRQEEESKRYQQ
FT                   KLTRIRNSVVNTFNHKVHRRNKRIKLGHKLVATHANIEKEEQKRAERKAKERLQALKAN
FT                   DEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTKAVKDQQKYTKDMLNQHLMEKKEESAE
FT                   PVVYNDDQMLTMSMNDDDDDEENIDYYNVAHRIKEEVRQQPSILVGGTLKEYQIKGLQW
FT                   MVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIKGPFLIIVPLSTLPNWSSEFA
FT                   KWAPKLRTISYKGSPNERKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVHMIIDE
FT                   GHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSFDE
FT                   WFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKC
FT                   KMSALQHAMYQQMLKHKQLFIGDQKKNKLVGLRGFNNQLMQLKKICNHPFVFEEVEDHI
FT                   NPTRDTNMNIWRVAGKFELLERILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYL
FT                   RLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQD
FT                   LQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEE
FT                   QEALLRSLLEAEEGRRRRREAGIEEEEELRDNEINEILARSEDDLALFSKLDTEREEAD
FT                   KAMHINSRLMTLDELPEIYHRNIDEELKKEESESAETYGRGTRERKQMIYSDNMSEEQW
FT                   LKQFEVSDSEDKDPNKIMELKDDETDVNSNTIKTESNEAIRSSSISIPSSPTQTMNNTP
FT                   ETNDLDSDSGEYAKKRKAPSTRPRGRPKKIKTDDGENNPTESITGDVGDNTEDVVKRAG
FT                   KTSIKSANTSSRGRGRGRGRGKPRGRAGMRGRGRPPKSKNGMVYVRMLPEDPVSEEERK
FT                   GIAEQATKLYDFALNYVNSDERRLSDIFLVKPSKHLYPDYYLIIKYPIAFDTIKDAIDR
FT                   LQYNSITEVMEDFHLMFANARVYNTEGSIIYEDAIELEDAMLQKYVEITNDTATLDFTE
FT                   FDAKYGTKPLHIQEPETHSTNENTPQDSSKDII"
     atggacgttc ccatgccaca acgccaacta acgaaggaag aaataaatag atgctatcta        60
     aagtggcagc aacttcgaaa tgaacacggt aagaacgctg ccaatgtacc cgaatttatc       120
     catctaacta aaattcttca tgtggctgcc aaacaacaac aagaacagaa gcaaaagttg       180
     caacagcaac aacagcaaca acagcaacaa cagcaggtac acgtaggtac accacaaaac       240
     gacaataaga acaacagcga accttggcgt gttgataacc caaatgggtc tacattctct       300
     cataataagg aacaactgga gacgtcaaca gaccaaaggc caccaaactt cacaatgaat       360
     ggtaccgagg gaagtgcgtc ttcagcatct cccgcaacta acccacaagt acaattttat       420
     aaaaaagaaa atagtaacaa tggtgcttcc caaagagaca attttcaatc gaggaccatt       480
     tctgacaatt caaactcgcc tgccacatca cctaagtctc aagtagttac acaaaatatg       540
     cctgtgcgta ataatagtca acctaataaa tcaattaact ccccacatac aattaacaaa       600
     cctaatgata gacaaacgca gccagcacct ctaaatccaa cacaacagag accggttccc       660
     caaaactcaa tatttacgcc acaacaatca gaattgctaa gagctcagat ttcggctctc       720
     aaaagccttg tcaataacca acctgtccca caagaatatc aaaaagtcat tcaacaatca       780
     attaacaatc cacctgattt caagcgcatg ctactctcct tgagcgattt tgtcaagaaa       840
     aagcagctta atcaacagag tggcagccca gcttctgaaa ttccagaacc acaaccacaa       900
     gcgcaaccac cggtgcaacc accaactgaa ccgcaagtgc aaccacaggc gacaccacag       960
     gcgcaatcgc aaccacatgc acaatcacag caacaggata aaaatagcac ctcagataac      1020
     gccaaaattg ataccaatac agcctcagct aacacatcaa tgacggaaga aaaaccaata      1080
     attaaaacag ggacaaatac accgaatgtc actcacgaac aaataccacc tgttggtgta      1140
     caagggacta gctctaatac actcagagaa gaaacacata aaacagatac cccatctcca      1200
     agaaccatac caggatctgt tacccatcaa attgcaacac caaatttgaa caaacaagag      1260
     aatcagaacc ctgaaacaca aaatcagtat gctttgaaac cgccaacaga aagagtgcca      1320
     gacccattgg tagatggtga gctaaaacct gctcaacaac tacctccagt acccattcaa      1380
     aagtttgttg aaaaataccc atatgttaag aatgttgtat cgattgaaga tccggactta      1440
     atggttgata cgttttctat tccaactatc cctgaggaac ctgttgatta ttattcctta      1500
     ttcccgaata ctgccaatcc taaactggta atggagccag gcatgttgcc tgctggcgtt      1560
     gacattcata cagcaacaga tatttatcaa accttaatag ctctcaatct tgatacatca      1620
     gttaatgaat gcatttctga catgctcgac gatagtaagg atgaaaatac caaagaggaa      1680
     actttatatg attattttgc cttgcagtta ttacctctac agaaagctgt ccgtggccat      1740
     gtactacaat atgaatggta tcagaattcc ttattaacga atgctcatcc taacttttta      1800
     tcgaagatca gaaatattaa tttcaatgat gtcttattaa ctatagaact gtatcgcaaa      1860
     cgtgaagtaa ttagacaaga agaagaaagc aagaggtatc aacaaaaact gaccagaatc      1920
     agaaattccg tagtcaatac atttaaccac aaggttcaca gaagaaataa aagaataaaa      1980
     ttggggcata aattagttgc cacacatgca aacattgaaa aggaagaaca gaaaagagcc      2040
     gaaagaaagg cgaaggagcg tttacaagca ttgaaggcta atgatgagga agcttatatc      2100
     aaactattgg accaaacaaa agatactaga attacacatc ttctaaaaca aaccaacgcc      2160
     tttttggatt ccttaacaaa agctgtcaag gaccaacaga agtacaccaa agatatgcta      2220
     aaccaacatc ttatggagaa aaaggaagaa tctgctgagc ctgtggtata taacgatgat      2280
     caaatgttaa cgatgagtat gaacgatgat gatgatgatg aggaaaatat agactattat      2340
     aacgttgccc ataggatcaa ggaagaagtc agacaacaac catcgatatt agttggtggt      2400
     acgttaaaag aataccaaat caagggttta caatggatgg tctcactttt caacaaccat      2460
     ttaaatggta ttttggctga tgaaatgggt ctaggtaaga caattcaaac aatttcccta      2520
     ctgacttatc tttatgaaat gaaaaatata aagggacctt tcttaatcat tgttccttta      2580
     tctaccttac caaattggag ctctgaattt gcaaaatggg caccgaaatt acgtacgatt      2640
     tcttataagg gctctcctaa tgaaagaaag atgaagcaag cacaaataaa atctggtgag      2700
     ttcgatgctg ttatcacaac gtttgaatat attattaaag agagggcaat tttgtccaag      2760
     gttaagtggg ttcatatgat tattgatgag ggtcacagaa tgaaaaatgc acaatcaaag      2820
     ctgtccctta cattaaacac cttctaccac tctgattatc gtttaatttt gacaggtact      2880
     cctttacaga acaaccttcc agaattgtgg gctttattaa actttgtttt acccaaaatc      2940
     tttaattcag caaagtcttt tgatgaatgg tttaatacac cttttgctaa tactggtggc      3000
     caagataaaa tcgaattaag cgaagaagaa acactattga ttattagaag actgcataag      3060
     gtcctacgtc ctttcttatt acgtcgtttg aagaaggatg tcgagaagga gttaccagat      3120
     aaagttgaaa aagttatcaa gtgtaagatg agtgcattgc agcatgcaat gtatcaacaa      3180
     atgctaaaac acaaacagtt gtttattggc gatcaaaaga agaacaagtt ggtaggcttg      3240
     agaggcttca ataaccaatt gatgcaatta aagaagatat gtaaccatcc gtttgttttt      3300
     gaagaagttg aggaccatat taacccaact agagatacaa atatgaacat ttggcgtgtt      3360
     gctggtaagt ttgaacttct agaaagaatt ttgcccaagt tgaaagcctc ccgccataga      3420
     gtactgattt ttttccaaat gacacagatt atggatatta tggaagactt tttgagatat      3480
     attgacatca aatatttaag attggatggt catacaagat cagacgaacg tggtgaactt      3540
     ttgaagcttt ttaacgatcc aaattctgag tacttttgtt tcatcctgtc tactagagct      3600
     ggtgggttgg gtttgaatct tcaaactgca gacacagtta tcatttttga tacagattgg      3660
     aatccgcatc aagatttgca agctcaagat agagcccata gaattggtca gaaaaacgag      3720
     gtgcgtatca ttcgtttgat cacgacaaac tctgtagaag aggtcattct tgaaagggcc      3780
     tataagaaac tggatattga cggtaaagtt attcaagctg gtaaatttga taacaaatca      3840
     acagctgaag aacaagaggc tttactgaga tccctattag aagctgaaga aggacgtagg      3900
     agaaggagag aagctggtat agaagaagaa gaagaactgc gagacaatga gatcaacgag      3960
     attttggcta gaagtgaaga tgatctagct ctattctcta agttagacac tgagagggaa      4020
     gaagctgata aggctatgca tattaacagt agattgatga cccttgacga actaccagag      4080
     atatatcaca gaaatattga cgaagaatta aagaaagaag aatctgaatc tgcagaaact      4140
     tatggtagag ggactagaga acgcaaacaa atgatttatt ctgataatat gtctgaagaa      4200
     cagtggttaa aacaatttga ggttagtgac tctgaggata aagatccaaa caaaataatg      4260
     gaattaaaag atgacgaaac agatgtaaac tccaatacca tcaaaactga atccaatgag      4320
     gcaatacgat caagcagtat atctatccct agcagtccga cacaaactat gaacaataca      4380
     ccagaaacaa atgatttgga ttcggacagt ggggaatacg cgaagaagag aaaggctcca      4440
     tccactagac cgcgtggtcg tccaaagaaa ataaagacgg atgatggaga aaataatcct      4500
     acagagtcca ttacaggtga cgttggtgat aataccgagg atgttgttaa aagggctggt      4560
     aagacttcaa taaagtctgc aaacacttca tccaggggtc gtggccgagg ccgtggtaga      4620
     gggaagccta gaggacgtgc cggtatgcgt ggacgtggta gaccgcccaa atcaaaaaac      4680
     ggaatggttt acgttcgtat gctacccgaa gatccagtct ctgaagagga gcgtaagggt      4740
     attgcagaac aagctacgaa actatacgat tttgccttga attatgtcaa tagtgatgaa      4800
     agaagactat ctgacatatt tttggttaaa ccttctaagc acttgtatcc tgattattat      4860
     ttaatcataa aataccctat tgcatttgac acaataaagg atgcaataga cagactacag      4920
     tataactcaa taacggaggt gatggaggat ttccacctaa tgtttgcaaa tgcgcgtgtt      4980
     tacaatacag aaggttctat tatttacgaa gacgccatag aactggaaga tgccatgcta      5040
     caaaagtatg tggaaattac aaacgatact gctactcttg atttcactga atttgatgcg      5100
     aagtatggga ctaaaccatt gcatatacag gaaccagaaa ctcattccac taacgaaaac      5160
     acccctcaag actcatcaaa agatataata taa                                   5193
//

If you have problems or comments...

PBIL Back to PBIL home page