(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE213

CAGLA1_12.PE213      Location/Qualifiers
FT   CDS_pept        537760..539520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195777"
FT                   /locus_tag="CAGL0M04917g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62537.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG124059"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniParc:UPI00003B70B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN3"
FT                   /transl_table=1
FT                   /translation="MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGAR
FT                   ASYSDSIGGDLDTMDNKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEK
FT                   ALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNP
FT                   SSIDVIYDELVELHVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYD
FT                   DARQIKLSEILQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDN
FT                   EDNVRSSQHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSP
FT                   KISLDEKPCNADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTS
FT                   LLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMK
FT                   TVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQ
FT                   FMVLFLLSFNAYLRDALDILISVQADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKS
FT                   NNNIVLRRLF"
     atgtatgaac aatttcagat gatatcaaaa aattctctca cacctataag agattataat        60
     aacgattttt tccatgcaaa tgattcaaaa cttccaaatc tgactcgtgt taaggatggg       120
     tatggtggcg cgcgtgcaag ttactctgat tcaattggag gtgacctaga tacgatggac       180
     aataaaatag atgacagggt gaagaaaagt tcaaattctt ctgtattaac tgacatgaag       240
     aatattaatc taagagaaat gcttaagaaa tttattttta gtgaggaaaa atacatagag       300
     atgacagaga aggcgcttac atcatatcgg tttaatatgc aaaataagaa aatgagaagc       360
     aagaaaatct ttgatcctaa ttcaaaggaa gatgttatac tttttggtaa tctggaaaca       420
     atatgtgctg ttagctattt atatttgaac tcgttgagta aaattgttac aaagctggag       480
     cttaatcctt caagtattga tgtcatatat gatgagctag tagagctgca tgtgacctta       540
     tttaatagaa tgaaacaacc atatactagc tatattattg cttatcagaa tcaaacacac       600
     cttgttaaaa tattggagaa ttcgacttca aagatagtag catcatggta tcatcggagt       660
     tatgatgatg ctcgtcaaat caaattaagt gaaatattgc aatgcccata taagcatgtt       720
     catgattggt tggagaatat aaaaattttg aaagaatggc tagttgtggg tacatcagtg       780
     gaagagtttc aaaaactgat tgagactttc acggactata ttagtcatct caatattgat       840
     aatgaggata atgtccgttc ttctcagcat cgtcatccaa tatcgagcat acaaatctct       900
     aaatcatcag atttaaatcc agaaagcagt ggaccttcag atgatggtaa ttttgttgcc       960
     tatattccca gtgtagcatc tagtgtatat acagaagtta tcaagcccag aatgagtcct      1020
     aagatatctc tagatgagaa accttgtaat gctgactcta atcatgcatt aatgttacta      1080
     gtccgactgt ttaaagaaaa attatatcac cttactcagc tgaggaaatt gttggttaag      1140
     catgatatta caaatctggc ggataatttt atcatgcaaa tacatagttg gacctcacta      1200
     ctgagtattg aaaaagactc tgtatttcag aatatccatg aacaattgaa taataaaatt      1260
     aatctttgtg taaagcttta caaagagaag aaagaagaac ttggtgcgtt taaatttctc      1320
     aagttagagt catttataat caagaagtta gagaccgttc tagcgttgat gaaaactgtt      1380
     aaaggttata ttaatgattt aaaagtgctg cataaggact atttaatatt caaaaaagag      1440
     aaacagatga aattgcagga cattaaacgt acattacttg gaacacatta tgaacaaata      1500
     caaaataaat tagtcgagca gctacctcga ttcctgactt atattaatca gttcatggtg      1560
     ttgttccttt tgagtttcaa tgcatacttg agagatgcac ttgatatact gatatcagtt      1620
     caggcagatt tactccatac tgaagaagga gtaaatgaaa ttgaaaagga ttacgacaaa      1680
     agaagaaatg tcatgaaaaa aactgtaaac agtcactatg aaaaatcaaa caacaatatt      1740
     gtactgagga gactatttta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page