(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE214

CAGLA1_12.PE214      Location/Qualifiers
FT   CDS_pept        539988..540689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348992"
FT                   /locus_tag="CAGL0M04939g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62538.1"
FT                   /db_xref="HOGENOM:HBG058151"
FT                   /db_xref="HOGENOM:HBG203497"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniParc:UPI00003B70B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN2"
FT                   /transl_table=1
FT                   /translation="MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLEN
FT                   KKKEVNELIVARFQILQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSK
FT                   KTRIQVKKKKSKKSSKDGEKKVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQV
FT                   WDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSR
FT                   LSVKLEDGTQA"
     atggaccaaa atatcgattt gaataactat gtgtcgatgt tagacgctat aattagtgta        60
     tctgatcctg ataaggttag tcccaaaaaa atacgtaagg ctttggaaca actgttctct       120
     gtatcattag agaataaaaa gaaagaagtc aatgagctta ttgtggcgag gttccagatt       180
     ttgcaagctg accctcatat attggtaagt aatgaagaat ttcaaaacct aaagatgata       240
     aggggaaact atgatgcact tctgtcatcc aagtcaatgg aaaagaagca caagttaact       300
     gaatcttcga aaaagacacg tatacaagtt aagaagaaaa aaagcaagaa aagctctaag       360
     gatggtgaga aaaaagtagc caatcctaat tcaaatgcca tcaattctat gaaattgaga       420
     ttatcagatg atctctacaa attcttagga gaacgggaac tcccaagaac tcaggttgtc       480
     aagcaagttt gggattatat taaggaacat aaccttcaaa gccccgaaga ccgtagagaa       540
     ataatatgtg atgataggat gaggcctata ttcggtgaca agatgacgat gttcgcgctg       600
     aataagatac tgtcaaagca tctgacaaaa atagagccta agagtgagga agctgataat       660
     agtagactat cagtaaagct agaggatggt actcaagcat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page