(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE215

CAGLA1_12.PE215      Location/Qualifiers
FT   CDS_pept        complement(540950..542158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195778"
FT                   /locus_tag="CAGL0M04961g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62539.1"
FT                   /db_xref="HOGENOM:HBG330467"
FT                   /db_xref="HOGENOM:HBG350158"
FT                   /db_xref="UniParc:UPI00003B70B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN1"
FT                   /transl_table=1
FT                   /translation="MATLHFTPKYEDDEVFSIAGKALKLTTKEDIQPHLDDLAKLKKCK
FT                   KLDFSGNTIGTEASKALADFLGSTESVRDVVEEINFADMYTSRLVDEVVDSLKALLPVL
FT                   LKCNKLTILNLSDNAFGLRTIDYLENYIANAVHLKHLILSNNGMGPFAGERIGKALFYL
FT                   AQNKTKAKESMLETFICGRNRLENGSALYLALGLKSHGDGLKVVKLYQNGIRPKGVATL
FT                   IHYGLKYNTKLEIIDLQDNTFTTAASLVLAKNLPLWKNTLVELNLNDCLLKAKGSKEVF
FT                   KVFEDNTFENLETLRFEYNEMEQDTLETVFLPAIEDNKFPKLKNLEINGNRFEEDSDPV
FT                   NALMDHFEDLELDDLEEPDSEEEEEEEEEEEKMEEIETSKIENELIELQIDNLAQELSK
FT                   ASI"
     atggctacac tacactttac accaaaatat gaggacgacg aggtcttttc cattgctggt        60
     aaggccttga agttgaccac aaaggaagac atccagcccc acttggatga cttggcaaag       120
     ctgaagaagt gcaagaaact agatttctca ggtaacacca ttggtactga agcttctaaa       180
     gcgttggctg atttcttggg atccacagag tcagtcaggg atgttgttga agagataaac       240
     tttgcagaca tgtacacttc gaggttagtc gatgaagtgg tcgatagttt gaaagcattg       300
     cttcctgtgc ttttgaaatg taacaagttg acaatattga acttgtctga taacgctttc       360
     ggcttgagaa ccatcgacta cttggagaat tacatcgcca acgccgttca cttgaagcac       420
     ttgatcttga gtaacaatgg tatgggccca tttgcaggtg aaagaattgg taaagctttg       480
     ttctatttgg cccaaaacaa aaccaaggcc aaggaatcga tgttggaaac cttcatctgt       540
     ggcagaaata gattagaaaa tggctctgct ttatacctcg ccctaggttt gaaaagccat       600
     ggtgatggtt tgaaagttgt caaactgtac caaaatggta tcagaccaaa gggtgttgct       660
     acgttgatac actacggttt aaaatataac accaaattgg aaatcataga cttgcaggac       720
     aacactttta caactgctgc ttctctagtc ttggctaaga atttaccact atggaagaac       780
     accctggttg aattgaactt gaacgactgt ctgctcaagg caaagggctc taaagaagtg       840
     ttcaaagtct ttgaagataa cacatttgaa aatctggaaa ccctgagatt tgaatataat       900
     gaaatggaac aagacacttt agaaactgtc tttttgccag ctatcgaaga taataaattc       960
     cctaaactaa agaatttaga aattaatggt aacagatttg aagaggattc tgatccagtt      1020
     aacgctttga tggatcactt cgaagatttg gaattggatg accttgaaga acctgacagt      1080
     gaagaagaag aagaggaaga ggaggaagag gagaaaatgg aagaaattga aacctcaaag      1140
     attgaaaatg aactaataga attacagata gataacctgg cacaagaact atctaaggct      1200
     agcatttga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page