(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE216

CAGLA1_12.PE216      Location/Qualifiers
FT   CDS_pept        complement(542562..543017)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501156"
FT                   /gene_name="MBF1"
FT                   /locus_tag="CAGL0M04983g"
FT                   /product="Multiprotein-bridging factor 1 "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /protein_id="CAG62540.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG023009"
FT                   /db_xref="HOGENOM:HBG521662"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniParc:UPI00003B70B5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJN0"
FT                   /transl_table=1
FT                   /translation="MSDWESHTVIGQKARAGGSGPRANVARTQGQINAARRQGLVLSVD
FT                   KKYGTANTKGDAEGQRLTKVDRETDIVKPKKLDANVGKTIARVRTEKKMSQKDLATKIN
FT                   EKPTVINDYEAGRAIPNQQVLGKMERALGVKLRGKAIGEPLGGPKKK"
     atgtctgatt gggaatctca tactgttatt ggtcaaaagg ctagagctgg tggttctggt        60
     ccaagagcca acgtcgctag aacacaaggg cagatcaatg ctgccagaag acaaggcctt       120
     gtcctttctg tggataagaa gtacggtact gccaacacca agggtgacgc cgaaggccag       180
     aggttgacca aggttgaccg tgagaccgac attgtcaagc caaagaagct ggatgccaat       240
     gttggtaaga ccattgcccg tgttagaacc gaaaagaaga tgtctcaaaa ggacctggcc       300
     accaagatca acgagaagcc aacagttatt aacgactacg aggccggcag agccatccct       360
     aaccaacaag tgctcggtaa gatggaaaga gctctcggtg tcaagctgag aggtaaagcc       420
     attggtgagc ctctaggtgg cccaaagaag aaataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page