(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE218

CAGLA1_12.PE218      Location/Qualifiers
FT   CDS_pept        544448..546676
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501157"
FT                   /locus_tag="CAGL0M05027g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62542.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059617"
FT                   /db_xref="HOGENOM:HBG735608"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI00003B70B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM8"
FT                   /transl_table=1
FT                   /translation="MITQASIPEVREDVIGFALGERKAILPQCQDLGPPDLITMVKYVP
FT                   TPNSNATAGTTSGNGAGGANNGTAGAANGNNSLSTADPAALLAEIHSHDKLKGAIGTFF
FT                   YTLGIDTSDPTSISISLKQIADAIAEKPQKWFGKFKNFSIARISLSTYNIFRRCDVNVI
FT                   VHIPGAVQTYVLDSNGEHLPVSGNQTTPTVASTASANPIDQASEMDVIWAETFISGVIR
FT                   SIMFMKDNADDGEAQPLVETLILNPLTAGKLDDVANTFIKLFPTVYERGVLTEAPCHVL
FT                   VPTRTNNYLVDTLVELVRLTKSVDICRPMLEELIKSYPDASIVLARVLMACDYEIDAID
FT                   IINRELLPHGEEDDTISPIFRAELLCLQTQFLMNVKNDYKLALEVALSAVKFSPSEFIP
FT                   WFLLTKIYIKLNDIENALLALNSCPMAQSHERYVLKRAVPIGSEDNLHLPLPENIGVDE
FT                   ILQLNPSDVNKEQLNSDPSLTRSAALNLKSTYLLAYRLLTEIVQITGWETLLKCRSKIF
FT                   VMEDEYQISTDEVSLTNQSNRNEDTPSELNMRTKRLCDRWLDNLFMLLYEDLKIYTLWQ
FT                   TEQLYFEAQNSKYKKLTYEWEAFGLCAQRLGHLPEAASAFQRGLSQRFAPMSARMLLNY
FT                   YIQEHHRVRNQSLSPNSELTSSQIISRINDLDSRIIDLCVKLCCWNHRWYIEFSIQLID
FT                   ALSVAVQDMGIMKVINEIASRYPDAVVSIMKENFLDFLENYTNGFFDA"
     atgattacac aggcgtcgat tcctgaagtg agggaggatg ttattgggtt tgcgctaggt        60
     gagagaaagg ccattcttcc acaatgtcag gatctgggac ctccggactt gattaccatg       120
     gttaaatacg tgccaacacc aaactcaaat gctactgcag gcaccacctc aggtaatgga       180
     gctggtggtg caaataatgg cactgctgga gcagctaatg gaaataattc cttgtctact       240
     gctgatccag ccgccctgtt ggcagagatt cactcccatg acaaactaaa gggggcaatt       300
     ggcaccttct tttacacact aggtattgat acatctgatc caacttctat ttctatctct       360
     ttaaaacaaa ttgctgacgc gattgctgag aagcctcaaa aatggtttgg caagtttaag       420
     aatttcagta tcgccaggat ttccctgtcg acatacaata tcttcagaag atgtgatgtt       480
     aatgtgattg tacacatacc aggtgcagta caaacctatg tactagattc aaatggtgag       540
     catttgcctg tctcaggtaa tcaaactaca ccaaccgtcg cttccacggc tagcgccaat       600
     ccaattgatc aggcaagtga gatggatgtc atttgggcgg agactttcat cagtggagta       660
     attcgttcaa ttatgtttat gaaggataac gccgatgatg gtgaggccca acccttggtc       720
     gaaactttaa ttttgaatcc attgacagca ggtaaactag acgacgttgc aaatacattt       780
     ataaagctct tcccaacggt ctatgaaaga ggtgtgttga ctgaagcacc ttgtcacgtt       840
     ttggtgccaa ctagaacaaa caactaccta gttgatactt tggtagaact ggttaggcta       900
     acgaaatcgg tcgacatctg tagacctatg cttgaagagc tcattaaaag ttatccagat       960
     gctagcatag tccttgcgcg tgtcttgatg gcttgtgatt atgagattga tgctattgat      1020
     atcataaaca gagaattact acctcatgga gaagaagatg atactatatc acctatattt      1080
     agagcagaat tgttatgcct acaaacacag tttttaatga atgttaaaaa tgactataag      1140
     ctggcgctgg aagtggctct atccgcagtt aaattttctc ccagtgagtt cattccatgg      1200
     tttctgctaa ctaagatata catcaagcta aatgatattg aaaatgccct tttggctttg      1260
     aattcatgcc ctatggctca atcacacgaa agatatgtcc taaagagagc ggtacctatt      1320
     ggatcagagg ataatctcca cctaccattg ccagaaaaca taggagttga tgaaatttta      1380
     caattaaatc ctagcgatgt taacaaggaa caattaaatt ctgatccatc tttaactaga      1440
     tccgctgctt taaatttgaa gtctacatat ctattggcat ataggttatt gacagaaatt      1500
     gtacaaatca caggctggga gaccctattg aagtgtagat ctaagatatt tgttatggag      1560
     gatgaatatc aaatatccac ggatgaggta tcattgacaa accagagtaa tagaaatgag      1620
     gacacaccaa gtgagttaaa tatgagaact aagagacttt gtgataggtg gttagataac      1680
     cttttcatgc ttctatatga agacttgaag atatacacat tatggcagac agaacagtta      1740
     tatttcgaag cacaaaatag taaatacaag aagctgacat atgaatggga agcatttggg      1800
     ctttgtgcac agagactagg acatcttcct gaagctgcta gcgcattcca aagaggtctt      1860
     tcccaaagat ttgctccaat gagtgcgcgg atgttattga attattatat tcaggaacat      1920
     caccgcgtga gaaaccaatc cttatcacca aactctgaac tcacatcatc gcaaataata      1980
     tcacgtatca atgacttaga ttctcgaatt atagatttat gtgtcaagct atgttgctgg      2040
     aaccaccgtt ggtacattga gttttcgata caacttatcg acgcgctgag tgtcgcagtt      2100
     caagatatgg gtatcatgaa ggtaatcaac gaaatagcgt ctcgttatcc ggatgccgtt      2160
     gtatctataa tgaaagaaaa cttcttagac ttcttggaaa actatactaa cggattcttt      2220
     gatgcttga                                                              2229
//

If you have problems or comments...

PBIL Back to PBIL home page