(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE219

CAGLA1_12.PE219      Location/Qualifiers
FT   CDS_pept        547489..548850
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437867"
FT                   /locus_tag="CAGL0M05049g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAG62543.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI00003B70B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM7"
FT                   /transl_table=1
FT                   /translation="MKLLFSLQLWVLIGTLFPDAGAINLQDNKDSICAATALIQGGMLD
FT                   YYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYD
FT                   YIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQS
FT                   CNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGY
FT                   IVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVL
FT                   GGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKA
FT                   SAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADN
FT                   GGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF"
     atgaaattac tgttttcgct tcaattatgg gtcctcatag ggactctttt tccagacgct        60
     ggtgcgatca atttgcaaga caataaggac tctatatgtg cagccactgc tttgattcaa       120
     ggtggtatgc ttgattatta tgaaggtact cgttacggtg gtactgtagg tatgtttcag       180
     cctccatact attggtggca agctggtgtt gcgtttggtg gtatgttaga aaattggttt       240
     ctatgtcaga acgacacata caaggatttg ttaatgaatg ctttggtagc gcaaactggt       300
     ccaaattatg attatattcc agccaatcag actacagtgg aaggtaatga tgaccaaggt       360
     gtttggggtc ttacaattct agatgcagtt gagcgtaact tctccgctcc aattgatggt       420
     aaaccaggtt ggttagccat gagtcaaggt atctttaata ctatgtacgc aagatgggac       480
     atgcaaagtt gtaatggtgg tctaagatgg caaattttca cttggaatag tggctacaat       540
     tataaaaaca ctatttcaaa tgcatgtcta ttccagatcg ctgctagatt gggtaggtac       600
     accggtaaca ccacttattt agatgttgca gaaagagtct ttgattggct tgttggtgtt       660
     ggttacattg tattgtctga gaaaggtaat gtttatgatg gtgccaaggt tgaggataac       720
     tgtactgaca tcaccgctat tgaatggact tataaccacg gtgttgtttt gggtgggtta       780
     gcttatatgt acaatgcaac caatggttcc tctgtatggc agtctagatt gacttcagtt       840
     cttggcggtg ctactgcata tttcttccaa gatgatatta tgtatgagag tgcctgtcaa       900
     ccatataaga catgtaacaa cgatcaaaga tgtttcaaga gtattttctc aagaatgtta       960
     ggtttcacta gtgtgttagc gccatttact agtgacacaa tcgatccatt gttaaaagct      1020
     agtgctatgg cagctgcagg ttcctgtgat ggtggtacag atggtcatac ttgtggtcta      1080
     gattggcaat taaagacaaa tgatggttac tatggtcttg gagaacagat gagtgcactc      1140
     gaagtaatac agcaactgct tatccatgag agacctgccc cataccgggc tgataatggt      1200
     ggaacttcag ttggtgatgc agctgctggt ttaaactcaa caacaacaaa tgttctaaag      1260
     aataacttga aaatcactgg tggtgaccgt gctggtgcgg caattgtaac aaccattgtg      1320
     ttaggtataa taattggagg tgctgcctgg atgatgtttt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page