(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE22

CAGLA1_12.PE22       Location/Qualifiers
FT   CDS_pept        70659..73721
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195504"
FT                   /locus_tag="CAGL0M00594g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62347.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124065"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6FF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK73"
FT                   /transl_table=1
FT                   /translation="MMTNGQDQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRH
FT                   QNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDKTIGRGKWDEKILNTPD
FT                   VWNNDIVKVKGNKASILPTVDYTMHRQDLVLKSNDGNDSQTGISSQNSITFNNMSVSVG
FT                   SSGVLEYESTSKRSTPGNHSSDSTPTDSSISRLRTEGSYTNTNNADGTLNPVPYHDLDL
FT                   SSSSSLSFATPSYQNTRTSNNPVPIGGGTPLDVNWLNSVLESDNKINELASKSLSPSAT
FT                   LGQKSDKHNNIADFKLSLPESKKNRRYSYPNNLNDTTAKQSNDKNYTGSPLNPNGRMHS
FT                   NGHNNPPSASNATITLNTSAGIENHTINDKDLFRPDLNHNPSLSSLFKTEDPTSSEQPV
FT                   IDIISQLSSEYTSPNDLSFVNLNQPNLGFFTQEWRDLILQKYSLLDNNFPTIKELNEYI
FT                   EQYQKEFHPYFAFLHLHSVQPSLSRISLFLSVAAIGAFYSYNSTHSNLLANLAYGEINQ
FT                   LIKSVKLDSSPLWLVQTMLVLGFYAIFNNDISLVQSASDQFVMIVKIVKSAKINQPLET
FT                   MVVPPTNLFPNPVTKTLTSDQIDAAYRYFITAQSRIHICHSMLFLSNIFPAMSGLEACF
FT                   LSSDVLCGVPCPYEDLYTSKSPGEWYNNVLKNSIEIANSSQLVNLSNGMVSFQTCLEYL
FT                   TTGNHVLYENIKLSLYTLLSLLVSIHEKILLERHKAKTEKDVQYNDTQWKLKQGPLIDS
FT                   VIRKWEILYMKNGGILLPTENNVAKITGSHVMRNNVSFYLFAKLKRCIDLNHVIQKIWM
FT                   RDWTTMNTALEEVIYDKESLQEATDYAISLLRSWASTFTILDDESMQAMKTPMFSMACI
FT                   FSSILIIAEYLRSVERWAKTFNAGDPNAKTMNPTDKILWLKAGRLLKMFQKKLMSSDAK
FT                   KYSEFAGVQKHEMLDITEVDESVLQRAIGLEAKVDETIQMILAASLASKALYIGVRVIG
FT                   DTPIWPISVLFAQGLQSRAVYCVMKDEGVFT"
     atgatgacta atggacagga tcaacactgt cttataccca agaaatctag ggcagtaaag        60
     accgacaaac cgaggccgtt tctatgtcct atatgttcta gaggatttgt acgtcaggaa       120
     catctgaaaa gacatcagaa tagtcacacc catgaaaaac ccttcttatg tttgatttgt       180
     ggtaaatgtt tcgcacgtaa ggacttagtt cttagacatt tgcagaaatt acaccgagat       240
     tataagaccg aacaattgga caaaacaata ggaagaggaa aatgggatga gaagatactt       300
     aatacacctg atgtttggaa caatgatatt gtcaaagtga aagggaacaa agcatcaatc       360
     ttaccaactg ttgactacac aatgcataga caggacttgg ttctcaaatc gaatgatggc       420
     aatgattctc aaactggtat cagcagtcaa aattctatta ctttcaataa tatgagtgtg       480
     agcgttggat caagcggtgt attggagtat gagagtacca gcaagagaag tacacctggt       540
     aatcattctt cagatagtac tccaactgat agctctatca gtcgattacg caccgaaggt       600
     agctatacaa acacaaataa tgctgatggc actctaaacc cagtaccgta ccatgatcta       660
     gatttatctt catcttcatc gctttccttt gcaactcctt cataccaaaa tacaaggact       720
     tccaataacc ctgtaccaat tggcggtggc actcctctgg atgtcaattg gctaaactca       780
     gtgttagagt ctgacaacaa gataaacgag ttagcctcga agagcttatc tccatctgca       840
     acacttggcc aaaaatctga taaacataac aatatcgcag atttcaagct ttccctaccg       900
     gaatcaaaaa agaacagacg gtatagctat ccaaataatt taaatgacac aacagcaaag       960
     caatccaatg ataaaaacta tactggcagc ccattgaatc cgaatggccg tatgcattcg      1020
     aatgggcaca ataacccccc ttctgcgtct aatgcaacaa taactttaaa tacttcggct      1080
     ggcattgaaa atcacaccat caatgataag gatctgttta gacctgatct taaccataat      1140
     ccatcgttgt catctctttt caaaacagaa gatcctacga gctcagaaca accggtcatt      1200
     gatattataa gccaactctc ctctgaatac acatcaccca acgatttgag ttttgtaaac      1260
     ttaaatcagc caaatctagg cttctttact caagaatgga gagatctgat tttacaaaag      1320
     tatagtctcc tggataacaa ctttccaact ataaaagagt tgaacgaata tattgaacag      1380
     tatcaaaagg aatttcatcc atattttgca ttcttacatc ttcactctgt tcaaccgtca      1440
     ttgagcagga tatcactatt tttatctgtg gcggcaattg gtgcttttta ttcctataat      1500
     tcaacacatt ccaatttgct ggcaaatttg gcttatggag aaattaacca actaataaaa      1560
     tctgtcaaat tagactcctc tccactatgg cttgtccaaa ccatgctggt cttaggtttt      1620
     tatgctattt tcaataacga catttcgttg gtacaatcag caagtgacca atttgtaatg      1680
     attgtcaaga ttgtcaagtc agcgaagatt aatcagcctc ttgaaacgat ggttgtacca      1740
     ccgacgaact tattcccaaa tccagttaca aagacactga cttcggatca gattgatgcg      1800
     gcttataggt attttatcac agcacaatct agaatccaca tttgccattc aatgctgttt      1860
     ttaagcaaca ttttccctgc tatgtctgga ttagaagctt gttttctatc ttcagatgtt      1920
     ttgtgtgggg tgccttgtcc ttacgaggat ctttatacgt ctaaatctcc tggagagtgg      1980
     tataataatg ttttgaaaaa tagcattgaa attgcaaata gcagtcagct agtaaattta      2040
     tcaaatggta tggtgagctt ccagacgtgc ttggagtatt taacaaccgg aaatcatgta      2100
     ttatacgaga acatcaaact gtcattgtat accttgctct ccctgctggt ttcaattcat      2160
     gaaaagatat tactcgaaag acacaaagca aaaaccgaaa aggatgttca atacaatgat      2220
     acacaatgga aattaaagca agggcctctg attgactcag taattcgtaa atgggagatt      2280
     ttatatatga agaatggagg tattcttttg cctacggaaa ataatgttgc aaaaatcaca      2340
     ggaagccatg ttatgaggaa taatgtatca ttttatttat ttgcaaaact gaaacgttgt      2400
     attgatctga atcatgtcat tcagaagata tggatgagag attggaccac catgaatacg      2460
     gcattagaag aagtaatata tgataaagaa tctttacaag aagctaccga ttatgctatt      2520
     agtctgttaa gatcatgggc ttctactttt actatattgg atgatgaatc catgcaggct      2580
     atgaagacgc ctatgttttc aatggcctgc attttttcat caatccttat cattgcagag      2640
     tatttgagat cagtagaaag atgggccaaa actttcaatg ctggtgatcc aaatgcaaaa      2700
     accatgaacc caaccgacaa gattttgtgg ttgaaggcag gaagactctt gaagatgttt      2760
     caaaagaaac ttatgtcatc agatgcaaaa aaatactcag agtttgcagg tgttcaaaag      2820
     cacgagatgc ttgatatcac tgaagtagat gaaagcgtac tacaaagggc tataggcctt      2880
     gaagctaaag tagatgaaac tatccaaatg attctggccg catctttggc ttcgaaagct      2940
     ctttatattg gtgtaagggt catcggagac acaccaatat ggcctatatc cgttctgttt      3000
     gcacaaggtc tgcaatcaag ggctgtgtac tgtgtgatga aagatgaagg tgtatttaca      3060
     taa                                                                    3063
//

If you have problems or comments...

PBIL Back to PBIL home page