(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE222

CAGLA1_12.PE222      Location/Qualifiers
FT   CDS_pept        complement(556347..557696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437870"
FT                   /locus_tag="CAGL0M05159g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62546.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG059624"
FT                   /db_xref="HOGENOM:HBG203499"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI00003B70BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM4"
FT                   /transl_table=1
FT                   /translation="MGKIGKVGKASKKKSRLTSELVDLYEKNSTEQVGTYQYSNAIQIE
FT                   HAVHKLVEAYQRILKLSPNIVQYYETLNSLSDPEKVPPQLISLFTRYPLKLAAEIKTLH
FT                   DLNKSTLLDDISGYEAKFDASNREPVLGDLELSDLQDLEDDDIGRLDLDLSVAKSSESS
FT                   ECITSKEKSSKWPPEMPEIKDHVIRARVFMHKSLVNDKVYLNESDIIKSNNERLEFLGD
FT                   SILNTVMTMIIYNKFPSLNEGNLTELRKKLVKNETLREWSELYELPKQLKSNLSPDVDL
FT                   STSKTSADIFEAYIGGLMEDDPKTNLVKIRKWLKKLAKPKIEEAMKTSIQLEPTNNLDM
FT                   NAKRKLYSLIGYAALKLHYHTVQRPTNENPVTIVQCRTGDGTILGVGKARNIKLAGVKA
FT                   AEDVLRKEDVIEKYAKLRASIPREQSVSKNEQPRTTNKEQGEKDICELSG"
     atgggtaaaa ttgggaaagt tgggaaagct tccaagaaga aatcccgatt aacgtctgag        60
     ttggttgact tgtatgagaa gaattcgact gagcaagttg gtacttacca atactctaat       120
     gctatccaga tagagcatgc ggtgcataaa ttggtggagg cttaccagcg tattctgaag       180
     ctgtccccga atatagtcca gtattatgag actttgaact cgctgtctga ccctgagaaa       240
     gtgccaccgc agctaatctc tttgtttacc aggtatccat tgaagttggc cgctgagatt       300
     aagacactac atgatctcaa caagtccact ctgctggacg atattagtgg gtatgaggcg       360
     aagttcgatg cttctaatag ggagccggtg ctgggtgatt tggaactcag tgatttacaa       420
     gatttggagg atgacgatat cggacggcta gacctggatt tgtctgtggc caagagtagc       480
     gaatcctctg agtgtatcac ttcaaaggag aaatcctcga aatggccacc ggagatgcca       540
     gagatcaagg accatgtaat tagagccaga gttttcatgc acaagtcact ggtgaatgat       600
     aaggtatatt tgaatgaaag tgatattatc aaatctaata acgaaagatt ggagtttttg       660
     ggtgactcta tcctaaacac agtaatgact atgattatct ataacaagtt cccgtcatta       720
     aatgaaggta acttgacaga attgaggaaa aaacttgtta aaaatgagac cttgagagag       780
     tggtcggaat tgtacgagct tccaaaacag ctgaaaagta acttgtctcc cgatgtcgat       840
     ctaagtactt ccaagacgtc cgccgatatt tttgaggcct atattggagg attaatggag       900
     gacgatccaa agaccaactt agtcaaaata agaaagtggc taaagaagct tgcgaagccg       960
     aagatcgaag aagcaatgaa aacaagtatt caactcgagc caacaaacaa tttagacatg      1020
     aatgccaaga gaaagctata ttcattgatt ggttatgcag ctttaaaact acattatcat      1080
     acagtacaga gacccactaa tgaaaatcca gtgacaattg tacaatgcag aactggagat      1140
     ggtactatac ttggggttgg taaggcgaga aatattaaac tggccggtgt gaaggctgct      1200
     gaggatgttc tgagaaagga agatgttata gagaaatatg ctaaacttcg tgcatccatt      1260
     cccagagagc aatcagtttc caaaaacgag cagcccagaa cgacaaataa agagcaagga      1320
     gaaaaggata tatgcgagct atcgggttag                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page