(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE223

CAGLA1_12.PE223      Location/Qualifiers
FT   CDS_pept        complement(558426..559691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501158"
FT                   /locus_tag="CAGL0M05181g"
FT                   /product="Similar to uniprot|Q02554 Saccharomyces
FT                   cerevisiae YMR240c CUS1U2 snRNP protein "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62547.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG203500"
FT                   /db_xref="HOGENOM:HBG253372"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniParc:UPI00003B70BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM3"
FT                   /transl_table=1
FT                   /translation="MARSKRKRSGVSDVKASIIDAIETTHKQPAKKKKRVNATPNLESE
FT                   YRELFKKFNGVEERDVEEDRNPKVASHEPTLRDDHVADAKSADAKSADAKSADAIPQPL
FT                   SNRKARLMNKPTLAELKSSVLTPQLIEKHDCDAKEPYFLASVKTSFNVVQVPSHWQSKR
FT                   DYLSGRSLLEKKPFELPDLIKQTGVDSMRNTLPEDEEQEKLKEQTRNAVRPKLGKLDLD
FT                   YKKLYDVFFKLGKKWKPDTMLPYGDVYYENRNLQGEARWRKLVKDRIPGRLSDDLRHAL
FT                   GLQPGQLPPWCLRMKDLGMPPSYPNMKIAGLNWDISNFKDNKYGKVSKSNWTNTPLFGA
FT                   ILQFDDHQQAPEVEVPEVEVEVEVPVPEVPVPEEVKKPEPVTSIPESHSAKPVNTIRGS
FT                   VEHGGIQDNVESAQDELANYKF"
     atggccagaa gcaagcgtaa gagatcgggt gtgtcggatg ttaaggccag tataatagac        60
     gcgatagaga ccacgcataa gcagcctgcc aagaagaaga agcgtgtgaa tgcgacacct       120
     aacctcgagt cagagtaccg ggagttattc aagaagttca atggcgttga agaacgggat       180
     gtggaagaag acaggaatcc taaggtagcg agccatgaac ctactttacg cgatgatcat       240
     gttgcagatg ctaaaagtgc agatgctaaa agtgcagatg ctaaaagtgc agatgccatc       300
     ccacagccgc tttcaaacag aaaggcaagg ttaatgaaca aaccgacgct tgctgagttg       360
     aaaagctctg tgctgacacc acagctgata gagaagcacg actgtgatgc caaggagcct       420
     tattttttgg cttctgtaaa gacgtcgttt aacgttgtac aagtgccgag ccattggcaa       480
     tcgaagcggg actatctatc tgggcggtcg ctgctggaga agaagccgtt tgagctgcca       540
     gacctgatca agcagacagg tgtggactcc atgaggaata cgctccctga ggatgaagag       600
     caagagaaac tgaaggagca aacgagaaac gcggtacgac ccaagcttgg aaagctagat       660
     ctggattaca agaagcttta cgatgtgttt ttcaagctag gaaagaagtg gaagcctgac       720
     acgatgttac cgtacggtga tgtatactat gagaacagaa acctgcaagg tgaagccaga       780
     tggcgcaagc tagtcaagga caggatacca ggcaggctca gcgatgactt gaggcatgcg       840
     ctaggcctgc agccgggtca gttaccaccg tggtgtctaa ggatgaagga tcttggcatg       900
     cctccgagct acccaaacat gaaaatagct ggtctaaatt gggatataag caacttcaag       960
     gacaacaagt acggaaaggt gagcaagagc aactggacaa acaccccact gtttggcgcg      1020
     attctccaat ttgacgacca tcaacaggca ccagaagtag aagtaccaga agtagaagtt      1080
     gaagtagaag taccagtacc agaagtacca gtaccagaag aagtaaagaa gccagagcca      1140
     gtgacgtcta taccagaatc acatagtgcg aagccagtca acaccatccg tggatctgtc      1200
     gaacacgggg gaattcagga caatgtcgag tctgcacagg atgagttggc caattacaag      1260
     ttctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page