(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE226

CAGLA1_12.PE226      Location/Qualifiers
FT   CDS_pept        complement(564780..565481)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437871"
FT                   /gene_name="MED8"
FT                   /locus_tag="CAGL0M05247g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 8"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62550.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191925"
FT                   /db_xref="HOGENOM:HBG204194"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniParc:UPI00003B70BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJM0"
FT                   /transl_table=1
FT                   /translation="MSGINGALVEDIKPDYSGVPGPALDSVRMRLAQLTHSLRRIRDDL
FT                   SRADLTQWYSLQSQINVTLSQLMSVTSTLQHFEDTLDSTIVYPLPKFPTTSHESLLTTL
FT                   LRKKNIPEVEEWIKDAIEASGVDTNMMRDDEIEKILEKNNEDSKWALEVFAKEFEKRES
FT                   NGDTADDLDVLGNALKPVKTSVRQRAQSPFQVEDVLKYMSRGEVDRGSSSQEGLSTNNE
FT                   QSGDKDIIMAD"
     atgtctggaa taaatggagc attagtggaa gatataaagc ccgattatag tggagtaccc        60
     ggtcctgcat tggactcggt gaggatgaga ctcgcccagt tgacacactc gttgcgtcgt       120
     atccgagacg atctttcaag agctgatttg actcagtggt attctctgca gtctcagatc       180
     aatgtgacat tatcgcagct tatgtctgtg acatctacat tacaacattt cgaagataca       240
     ctggactcaa caatagtata ccctttacca aagttcccta ctacatctca tgaaagtcta       300
     ctgactacat tactaagaaa aaagaacata cctgaagtag aggaatggat taaagatgcc       360
     attgaagctt caggtgtgga tacgaatatg atgcgtgatg atgaaattga gaaaatactg       420
     gaaaagaaca acgaggactc taaatgggct ttagaagtat ttgccaagga gtttgaaaag       480
     cgtgaatcta atggggatac cgctgacgac ttagacgtgt tggggaatgc attaaaacct       540
     gtgaagacgt cagtacgaca aagagcacag agtccattcc aagtcgaaga tgtcctaaaa       600
     tatatgtcaa gaggagaagt tgatcgtggt agcagttcgc aggaaggact ttctacaaat       660
     aacgaacaat ctggtgacaa agacatcatt atggcagatt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page