(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE227

CAGLA1_12.PE227      Location/Qualifiers
FT   CDS_pept        565772..566170
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501160"
FT                   /gene_name="AIM4"
FT                   /locus_tag="CAGL0M05269g"
FT                   /product="Altered inheritance of mitochondria protein 4 "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62551.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124063"
FT                   /db_xref="HOGENOM:HBG512096"
FT                   /db_xref="UniParc:UPI00003B70C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL9"
FT                   /transl_table=1
FT                   /translation="MVHSDNNIIKDPKRNGEKPVEMILNGNRKESKRYNEQLSSLEERK
FT                   QKKKLKVVQEDSAYMDQSANQTSSAGLDKDTNELGPKSIFYDPDWNPKGEAPDGFRNVP
FT                   YNPKTFKRLHNQIEEDLGSLSGKLKYPE"
     atggtgcatt ctgataataa tatcattaag gacccgaaga ggaatggcga gaaaccggtg        60
     gagatgattc tgaatggtaa caggaaagaa tcaaaacgct acaatgaaca gctgtcgtca       120
     ttagaagaaa gaaagcaaaa gaagaaacta aaagtagtcc aggaagactc agcttatatg       180
     gaccagagtg ccaatcaaac tagctctgcc ggtttagaca aagataccaa tgaattagga       240
     ccgaagagta tattttatga ccctgactgg aatcccaaag gagaagcacc tgatggtttc       300
     agaaacgtac cttataatcc caagacattc aaaaggctgc ataatcaaat agaggaggat       360
     ttaggttctt tatcaggtaa gttaaagtat cctgagtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page