(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE229

CAGLA1_12.PE229      Location/Qualifiers
FT   CDS_pept        complement(567906..568646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437872"
FT                   /locus_tag="CAGL0M05313g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62553.1"
FT                   /db_xref="HOGENOM:HBG124064"
FT                   /db_xref="UniParc:UPI00003B70C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL7"
FT                   /transl_table=1
FT                   /translation="MDIEFGSPLKPSKSEDLERAAKQPEDVKNEFHAPVKSFPDLKNIA
FT                   AEADAAMVADLKKKLKGKTKKLKHKDKDRAKRIDQPTLSTATSYSTIHGFSNRRGNMED
FT                   QTSSHRSGSPPFFNNSLSSRGDLQSRQSHKPDSKWTEIDMLDDVRRMAKDKFFEGGFPE
FT                   EFEENLTKNRMSQAKLFQIMRDRNEKLAKTKRRTIRASHVDTRSQSHVEDEGMEPFDQD
FT                   ELESTKQEEKAYVKEIIDTISSLR"
     atggacattg aatttggtag tccgttgaag ccaagtaaat cggaggattt agagagggct        60
     gcaaaacaac cggaagatgt aaagaacgag ttccatgcgc cagtgaaaag ttttcctgac       120
     ttaaagaata tagcagctga agcagatgct gctatggttg ctgatctaaa gaaaaagctc       180
     aaagggaaga ccaagaaatt gaaacataaa gataaggata gagcgaagcg aatagaccag       240
     ccaacgctga gtactgctac ttcctactca acaatacatg ggttttcaaa cagaagaggt       300
     aacatggagg atcagacttc cagtcatcgt agcggtagtc caccattttt taataactca       360
     ttaagtagtc gcggagattt acaatctaga caatcgcata agccggattc aaaatggaca       420
     gagatagata tgttggatga tgttagaaga atggccaaag ataaattctt tgagggtggt       480
     ttccctgagg aatttgaaga aaatctaact aagaatagga tgtcccaagc gaaactgttt       540
     caaatcatga gagatcgtaa tgaaaaactc gccaagacta agagaaggac aatacgtgca       600
     tcccatgtag atactagaag tcagtcacat gtggaggatg agggtatgga accgttcgat       660
     caagatgagc tggaaagtac caagcaggaa gagaaggcgt atgtcaaaga gataattgat       720
     actattagta gtttaagata g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page