(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE230

CAGLA1_12.PE230      Location/Qualifiers
FT   CDS_pept        complement(569132..571552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348993"
FT                   /locus_tag="CAGL0M05335g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62554.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG027600"
FT                   /db_xref="HOGENOM:HBG559818"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B70C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL6"
FT                   /transl_table=1
FT                   /translation="MSGKEKDQKNVKGAAAGAKSGAKAPANGSRPSGQFSASDLNRIVL
FT                   EYLNKKGYHRTEAMLRAESSRTATPVNKNSPANTKDGSLPEPSTVPPAQDANAKPVSNP
FT                   VDSASAKRDASGEVVLKDKVRQDMSPEHYIRAYTMLKNWVDSSLDIYRSELSYIMYPVF
FT                   IYLFLYLVSKDPIYARRFFDKFSSDFRVKHGSEINRLFSVNSVDHIKENEVAKAFNGNR
FT                   YRVTISRAAFYLMLYFLTDNEGVGGSLIIGIINDHIQPNVMDTVRSKDRISDGVEIAAD
FT                   TAGTDGLAEINNAPVTLGPFPKDEEFVKEIETELKIKDDQEKKQIEQSKKGDGSKEGSV
FT                   ASEDVAKEPTADLDDTNDRPTLLQEYRKMNGDESSATPQEESDAAADKQDGKSGDSTKV
FT                   KSEDKKTAVAVVKTEEVAAMMSSPSKDTLPLPPKTALDIKIEIQKVKESRDAIKLDNLQ
FT                   AALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQF
FT                   DRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNH
FT                   PVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTG
FT                   SSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRI
FT                   KQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDI
FT                   TASINQDIKDYGRRRTIIPTNDLVASFYTKRSPVFKVKFTRSNLALAGGAIRE"
     atgtctggta aagagaaaga tcagaagaat gtgaaaggtg cagctgcggg tgctaagagt        60
     ggtgcgaagg cgcctgccaa tggttctagg ccgagcgggc agttctccgc gtctgatctg       120
     aacaggattg tgctggagta cttgaacaag aaagggtacc accgtaccga ggcgatgctg       180
     agggctgaga gttcgcggac cgctacgccg gtgaacaaga actcgcctgc gaacaccaag       240
     gacgggagct tgcctgagcc ttccacagtg ccgcctgcac aggatgcgaa cgctaagccc       300
     gtgagcaatc ctgtggactc tgcgagtgcg aagcgtgacg catcgggtga agtggtgctg       360
     aaggacaagg tcaggcagga catgtctccc gaacactaca taagggccta cacaatgctg       420
     aagaactggg tggactcctc cctggatata taccgctccg agctgagcta tatcatgtac       480
     ccggtgttca tatacctatt cctgtacttg gtctctaagg acccgatata cgcaaggaga       540
     ttctttgaca aattctcctc ggactttaga gtcaagcacg gctctgagat taacaggttg       600
     ttcagtgtaa actccgtcga tcatataaag gaaaatgaag tcgcaaaggc gttcaacggc       660
     aaccggtata gagtgaccat cagccgcgcg gccttttact taatgctata cttcctcaca       720
     gacaatgaag gcgtaggggg ctcattgata ataggtataa taaacgatca catacagcct       780
     aacgtaatgg acacagtgag gtccaaggac agaatctcgg acggtgtaga gattgcagcc       840
     gacacagctg gtacagacgg tctggctgag ataaataacg cacctgtgac attgggacca       900
     ttcccaaagg atgaggaatt cgtaaaggaa atagagactg agttgaagat caaagatgac       960
     caagagaaga aacaaataga acaatcgaag aaaggggacg gctcaaagga aggctccgta      1020
     gcatcagaag acgtcgccaa agaaccgacc gcagaccttg atgatacaaa cgatagacca      1080
     actctactcc aagaatatag aaaaatgaac ggtgatgaat cttcagcaac tcctcaggag      1140
     gaatctgatg ctgcagctga taaacaggat ggaaaaagcg gagactccac taaggtcaag      1200
     tcagaagata agaaaacagc tgttgctgtg gtaaaaactg aggaagtagc agccatgatg      1260
     agttctcctt cgaaggatac tttaccttta cctcctaaga cggctcttga tatcaaaatt      1320
     gagattcaaa aggtcaagga atctagagac gctattaaac tggacaatct acaagcagca      1380
     ctacccagtg tttgtatgta cacatttcac aacaccaata gggatatgac atctttggaa      1440
     ttcagtgatg attgtaggtt ggctgctgct gggttccaag atagctatat taaaatctgg      1500
     tccttagatg ggtcctcatt gataaatccg aagtatagtt cctctcaatt tgatagattt      1560
     tctcaggata acacttgttc aacattagtt ggccatagtg gtacagttta ctcaactagt      1620
     ttcagccctg ataacatgta tttagtttcc ggttcagagg ataagacggt gaaattatgg      1680
     tctatggata cgcatactgc gttagtgaat tataaaggac ataatcaccc agtttgggat      1740
     gttaaattct cacctttagg ccattatttt gcatctgcct cacacgatca aacggccaga      1800
     ctatgggcct gtgatcatat ctatccatta agaatctttg cagggcatac aaatgatgtt      1860
     gatacagttt ccttccatcc aaacggttgc tacgtattta caggttccag tgacaagaca      1920
     tgtagaatgt gggatgtaag tactggtgat tccgtgagat tattcttagg ccacactgct      1980
     cctgtattat ccacacaagt atctccagat ggtagatggt tggctactgg tagtgaagat      2040
     ggtgtgatat gtctatggga tatcggtact ggtaagagaa tcaagcaaat gcgtggacac      2100
     ggtaagaatg cagttcattc gttatccttt aataaagagg gaaatgtttt gataagtgga      2160
     ggtgcagacc actcagtacg tgtttgggat gtcaaacacg gtaccactga acaagggcca      2220
     gaaccagaac agccatttaa cgcacacgta ggcgacataa cagcatcaat taatcaagat      2280
     atcaaagatt acggaagaag aagaacaata atacccacaa atgacttggt tgcttctttc      2340
     tacactaaga gaagtccagt attcaaagta aagttcacta gaagtaactt ggctttagct      2400
     ggtggtgcaa tcagagagtg a                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page