(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE235

CAGLA1_12.PE235      Location/Qualifiers
FT   CDS_pept        580648..583446
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437873"
FT                   /gene_name="COS111"
FT                   /locus_tag="CAGL0M05445g"
FT                   /product="F-box protein COS111 "
FT                   /protein_id="CAG62559.1"
FT                   /db_xref="HOGENOM:HBG124068"
FT                   /db_xref="HOGENOM:HBG204203"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00003B70C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL1"
FT                   /transl_table=1
FT                   /translation="MQSVNIVSTNYSRYGVSVYDRLYRKDKNVSAKHRPSSTGVYGHDA
FT                   STVDHASRSNNNLNLTRSTSAISESDDVATISTNNSRRSVIKRKYKSLITASSKKLITK
FT                   LYEHGSNSDSFSIFSHKTSQSHHPAQRLGTEEDLIINDLFKRKEISDLPDEVLRNILSN
FT                   VKDDQRTLVNCLYVNKAFYNATKPTLYERPKFTSTYRVAQFVTSIRTNPQNGLYVRELD
FT                   LSKLKNGSLNGKSTSNTGVVADSPDVDEYNPMRTRTGSVTSFTSVTSTANSNTALSITT
FT                   NNKDVALAGWRDWRYRHDPLYSSPVLNSYNAKRTVSRAPSIKSSHSSSSLTLFPGLKSK
FT                   ESFAQLSEGKSSDNGNNGKRQRSNSSVSSITNSLMSSLYNGSHISLNTTLSGSDNNSSK
FT                   TQSKGKSSSSPGNPNDSSGEQDSIISSSSQIDTNTFGMTSSKSTSSTSNWFRMKLHGNG
FT                   TRKLRLRSNKAISSKKDEQQNEESAQTAQKIETPIIKRTEPFSTPHPYTNKFLLKYAQY
FT                   KDLPLGYILHILDHCPYLYILDLSNLTLCTDFEIIEGRRYKGRKQRFGSSRALPVVQES
FT                   VISTDVPNDLDVIYLTDSSKTYEYYDRLRNTNKHKRSSSSNNLWSIPNQGWSDAPAPIG
FT                   SHKNDLRRTHSQTIGRSNVELRKLNASEIFEHIATNQKSAYNTHLRVYMKNVLWCTQDM
FT                   VKSFVLENFDQQAENLGEDKSSEMFIHDMNFSFENSGLNRNFVWTCEGNLQEFIAMVVL
FT                   DEVNRKDDLEIENLFNIKAERILTPTNGPERAPEVHYISNVFTVSYGFQSNKKREMKFR
FT                   VTILKTDTPMYFSIKKLADDYTSVVIKLQTNKNVALHGSETADIITTDQGSVLPEDVPE
FT                   DNNADDTNNGENTIAQPFSNDPKERIERITQEIVARLKDLRGSDLRRNIGENNYVRERF
FT                   LL"
     atgcagagtg ttaacattgt gagcactaac tattccagat atggggtttc tgtctatgac        60
     agattatacc ggaaggataa gaacgtttct gctaaacata ggccttcctc tactggtgtt       120
     tatgggcacg atgcaagtac tgtggatcat gccagtaggt ctaacaataa tttgaacttg       180
     acaaggtcca cttctgccat ttcagaatcc gatgacgttg ctactatttc tacgaataac       240
     tccagaaggt cagtgatcaa gcggaaatat aagtcgctga taactgcatc ctcaaagaaa       300
     ttaatcacga agctatatga acatggttcc aacagtgatt ccttttccat attctcgcat       360
     aagacttcgc aatcacacca tccggcccaa cgattgggaa cagaggaaga tttaatcata       420
     aatgacttat tcaaacggaa ggaaatatca gacttgcctg atgaagtcct gaggaatatc       480
     ttgagtaatg ttaaagacga ccaaagaacc ttggtcaact gcctttatgt gaataaagcg       540
     ttctataatg ctacaaaacc aactctatat gagcgtccta agtttacttc aacatatcga       600
     gttgctcagt ttgttacctc cattagaact aatccacaga atggtctcta tgtgagggaa       660
     ttagatttat ctaaactgaa aaacggatcc ctaaatggga aaagcacctc caatactggt       720
     gtagtagcag attctccgga tgtggatgaa tacaatccta tgcgtactag gacgggctcg       780
     gtgacaagtt ttacctctgt tacctccact gctaattcaa acactgctct atcgatcacg       840
     accaataata aggatgtcgc attagctgga tggagagatt ggagatacag acacgatcca       900
     ttgtactcgt caccagtact taacagctac aacgccaaga gaactgtgtc tagagcacct       960
     tctataaagt cttcacactc aagctcatca ttaactctat ttccgggctt gaagtctaag      1020
     gaaagcttcg cacaactttc cgaaggtaaa agttctgaca atgggaacaa tggcaaaaga      1080
     caacgctcta acagctctgt atcatcgatt acaaacagtt taatgtcctc tttgtacaat      1140
     gggtcacata tctctttaaa taccactctc tcaggctccg acaacaatag cagcaaaaca      1200
     caatcaaaag ggaaatcctc atcatcacct ggaaatccta atgattcctc tggggagcaa      1260
     gatagtatta tatcaagcag ttctcaaatt gatactaaca cctttggcat gacttctagc      1320
     aaaagtacaa gttcaacttc aaactggttc agaatgaaat tacatggcaa cggtaccaga      1380
     aagttgagat tgagaagcaa caaggcaata agctctaaga aagatgaaca acaaaacgaa      1440
     gaatctgctc agacagcaca aaaaattgag actccaatta taaagagaac agaacccttc      1500
     tcaacgccac atccgtacac aaataagttc ctgctgaaat atgcacaata caaagattta      1560
     ccacttgggt atattttaca tattttagat cactgcccat acctatacat actggacctt      1620
     tcaaatttga cgttgtgcac agattttgag ataattgaag gacgccgtta taagggaagg      1680
     aaacagaggt ttggttcatc cagagctctt cctgttgttc aagaatcagt gatttctacc      1740
     gatgtcccta atgatctcga cgttatctac ttgaccgatt cgagcaaaac atacgagtat      1800
     tatgaccgcc ttagaaatac aaacaaacat aagcgctcat ctagctcaaa taatctatgg      1860
     tcgataccca atcaaggatg gtctgatgct ccagccccta taggatccca taaaaatgat      1920
     ctaagaagaa cacattcgca aacaattggc agatcaaatg tagagctacg aaagctaaat      1980
     gcctcagaaa tttttgagca tatcgcaaca aatcaaaaat cggcgtacaa cacacatttg      2040
     cgtgtatata tgaaaaacgt tttgtggtgc acccaagata tggtaaagag ctttgtatta      2100
     gaaaactttg atcaacaagc tgaaaattta ggtgaagaca aatcatctga aatgttcatt      2160
     catgacatga atttcagttt tgaaaactct ggtttaaata ggaattttgt ttggacctgt      2220
     gaaggtaatc ttcaagaatt tatcgcaatg gtggtgctgg atgaagtaaa tagaaaagat      2280
     gatcttgaga tagaaaattt attcaatata aaagctgaac gaattttgac tcctaccaat      2340
     ggaccagaga gagctcccga agttcattat atctcaaatg tatttactgt ttcatatgga      2400
     tttcaaagta ataagaaaag ggaaatgaag ttcagggtca ctattctgaa gacagatact      2460
     ccgatgtatt ttagtatcaa gaaactcgct gacgattata cttctgttgt gatcaagctt      2520
     cagacaaata aaaatgttgc actacatgga tctgaaactg cagatataat tactacagat      2580
     cagggcagtg ttctaccaga agatgtacca gaggataaca atgcggatga tacaaataat      2640
     ggtgaaaaca caattgccca acccttttcc aacgatccca aagaaaggat tgaaagaatc      2700
     acacaagaaa ttgttgctag gctgaaggat ttaagaggat cggacttgag aaggaatata      2760
     ggtgagaaca attatgtgag agagagattt ctcttgtag                             2799
//

If you have problems or comments...

PBIL Back to PBIL home page