(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE236

CAGLA1_12.PE236      Location/Qualifiers
FT   CDS_pept        complement(583722..584786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437874"
FT                   /locus_tag="CAGL0M05467g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62560.1"
FT                   /db_xref="HOGENOM:HBG124069"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B70C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL0"
FT                   /transl_table=1
FT                   /translation="MEVLREACSLEGELVNGRVDDILAKYEQVPQRELSRVIDSRDFEV
FT                   RFLKERTRVVTLDGIDMRCFDNIRDGERRDSVFLLIHGLGGSMDQFQPLMKLLTLLKYR
FT                   VIALDLPGFGQSGSSTNGYDMLYVTSVVKKVVDNNIENKTDIDFKVVGHSMGCYIASHF
FT                   VQMYHEEYNIDKLVLTCPPPPSISTLRQDNYIMKMAMRGLMWAPFIFNIYRVWFDQSKG
FT                   LNSSGIMNFFSANTETFQDEETENKNLKFRKLWQFSNNIKIDTSTIFSYFLGWKFPDWE
FT                   DLDNIINTNNVELVVIYAEHDKITPKQDAQLIFDAFKNVAATKKKLLEITNCGHNIFFN
FT                   CPEKACKLFQEQVF"
     atggaagttt tgagagaggc gtgctccttg gaaggtgaac ttgttaatgg tcgggtggat        60
     gacatacttg ccaagtatga gcaagttcca cagcgggagc tttcacgggt aattgacagt       120
     agggattttg aagtgcggtt cctgaaagaa agaacgcgag tggttacact tgatggtatt       180
     gatatgagat gttttgataa tattagggat ggggaacgca gagattcggt atttctcctc       240
     atacatgggc tgggaggatc tatggaccag ttccaaccct tgatgaaact gttgactttg       300
     ttgaaatata gagtgattgc tcttgatttg cctggttttg gtcaaagtgg ttcaagtact       360
     aacggttatg acatgttata tgttacttcg gtggttaaga aagttgtaga caataacata       420
     gagaacaaga cagatattga ttttaaagtt gtgggtcatt ccatgggatg ttatatagct       480
     tctcattttg tgcagatgta ccacgaggaa tacaatattg ataaactggt tctaacatgc       540
     cccccacctc ctagcatcag cacactaaga caggacaact atattatgaa gatggcaatg       600
     agagggctta tgtgggcacc ttttatcttc aacatatata gagtgtggtt tgatcaaagc       660
     aagggtctga acagttctgg aattatgaat ttcttcagtg ccaatacaga aactttccag       720
     gacgaagaaa cggagaacaa gaatttgaag ttcagaaagc tctggcaatt ctccaacaat       780
     ataaaaattg atacttctac aattttctcc tactttttgg gttggaaatt cccggattgg       840
     gaggatttgg ataatatcat taatacgaat aatgtagaat tggtggtgat atatgccgag       900
     cacgataaga tcactccaaa acaggacgca cagctgatct ttgacgcttt taaaaatgtt       960
     gccgctacta aaaagaaact tctggagatt actaactgtg gtcataatat ttttttcaat      1020
     tgtcctgaga aggcttgcaa attatttcag gaacaagtgt tttaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page