(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE239

CAGLA1_12.PE239      Location/Qualifiers
FT   CDS_pept        complement(588667..594171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437877"
FT                   /locus_tag="CAGL0M05533g"
FT                   /product="Similar to uniprot|P32528 Saccharomyces
FT                   cerevisiae YBR208c DUR1 urea amidolyase "
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="lyase activity"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62563.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG304781"
FT                   /db_xref="HOGENOM:HBG567256"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI00003B70CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK7"
FT                   /transl_table=1
FT                   /translation="MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPE
FT                   DPAWISVATESLLEQQWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYM
FT                   PTRDSTVVELLKQAGAIIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSA
FT                   SVVARGIVPIALGTDTAGSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSM
FT                   NLSDAEKCLKIMTKLDIENDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYD
FT                   RAIDNFKQLGAQIKIIDFEPLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVY
FT                   GIIKSATKFDAADAFEYEYKRQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILV
FT                   NSRQGTWTNFVNLADLSALAIPVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYP
FT                   SGTRPYGMFLDRYVGLKDDSLEGPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFIC
FT                   STKTAKKYELYALPKNGPVLKPGLRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLG
FT                   IGSVELENGKWVKSFICEESGYNSTGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLV
FT                   ANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKI
FT                   ISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKS
FT                   AGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVK
FT                   HQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPA
FT                   PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEM
FT                   VTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFP
FT                   NDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYL
FT                   KSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTIQDYPGRVNYWRIGVPPCGP
FT                   MDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSIAGGEVCCKLDEKKIPMFE
FT                   PISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFTMGNLGGFNGRALKRGDV
FT                   LSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLAGPHGAPDIFESEGMME
FT                   FFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDYVYSLGAINFTGDEPV
FT                   IITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSARNLKENQDVIINDM
FT                   SSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYILIEYGDDIFELNLC
FT                   YRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLIAYEEQLPQEKNW
FT                   SVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNNLTHDDIRQLIY
FT                   TTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGGSYMCIYAADS
FT                   PGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSEEQIDEYTDEWDNGNYKI
FT                   DVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLKQTTTEVIEQ
FT                   NILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFL
FT                   FKNGDMVDAGDPVAIIQCL"
     atgactgcta ctaatatttg cccttcaata ggctggtcta tccaggattg gatagacttt        60
     cacttcaaat ccacccctaa ggattcatat gaatctcttc ttgagttagt gaagaatcaa       120
     agaattgcac cagaggaccc agcatggatc agtgtggcaa ccgaatcatt gctagagcaa       180
     caatggcagt tgttgcaaag tagacacgag aaagagaaat taccacttta cggtgttcct       240
     attgcagtaa aggataacat cgatgcaaag ggtttcccta caacagcagc ttgcccatcc       300
     ttctcttata tgccaacaag agacagtact gttgtagaat tgttgaagca ggctggagct       360
     atcattattg gtaagactaa tttagatcaa tttgctacag gtcttgtcgg aactagatcg       420
     ccatatggcc gcactccttg tgttttcagt gataagcatg tttctggggg ctcttcagcg       480
     ggttctgcgt ctgttgtagc tagaggaatt gttcccatcg cattagggac agatactgca       540
     ggctcgggaa gagttcctgc ggcacttaat aatattattg gcttaaagcc tacaagagga       600
     atattctctt gtagcggtgt tgtcccagcc tgtaaatcat tggattgtgt ttctgtcttt       660
     tcaatgaatc tttcagatgc tgagaaatgt cttaaaatca tgaccaaact tgatattgaa       720
     aatgatgaat attcaagatc atttccagct aatcctcttc aaagctttaa caagaatctc       780
     actgtcgcta ttcctaagaa tgttatgtgg tatggtgaaa aagagaaccc actcttatat       840
     gatagggcca tcgataattt caagcaatta ggagcacaga taaaaattat tgatttcgag       900
     ccacttttag aacttgcccg ttgtctttat gagggaactt gggtagcaga aagatatgct       960
     gctacaagga agtttctaga aacatccccc caacagagta ctcttgatcc agttgtttat      1020
     ggtatcatca aaagtgcaac taaatttgat gctgcagatg cttttgaata cgaatacaaa      1080
     cgccaaggta tactgagaaa agtggaggtc ttactgcaag atatcgatgt cctatgtgta      1140
     ccgacctgcc cactaaaccc atcctttgaa gaagttgaca aagagccaat actagtcaac      1200
     tcaaggcaag gaacatggac taattttgtt aacttagctg atctatcagc tttagcaata      1260
     cccgtaggat tccgttctga tggattgcct aatggtgtaa cactaatagc caaaaaattt      1320
     gaggactatg ctttacttca actggcaaaa cggtttttag ctcagctata tccaagtggt      1380
     accagaccat atggaatgtt tttagacaga tatgtcggat tgaaagatga ctctttagaa      1440
     ggaccaattg taagctctga tgattctata gttttagctg ttgtgggtgc ccatttaaga      1500
     ggattaccac ttcattggca attggagaaa gttaatgcta catttatttg ctcgacaaaa      1560
     acagccaaaa aatatgaact atacgcattg ccaaaaaacg gccctgtttt gaaaccaggt      1620
     ttgagaagaa ttacaagtgg aacaggttct caaatcgaac ttgaattata tagtgttcct      1680
     aaagaaaagt ttggtgaatt tatttctttt gttccagaac cactaggaat agggtcggtg      1740
     gaactggaaa atggaaaatg ggttaagtct tttatatgtg aagaaagtgg ttataacagt      1800
     acaggttcta tagacatttc tcattacggc ggctttaggg cttacattga gagtataata      1860
     ccatctaatg aatcaaaaaa aggacacttc aagacagtat tagttgcaaa tagaggagaa      1920
     atagctgtgc gtattataaa aacactgaaa tcaatgcaaa tcaaatcact agccatttac      1980
     tctgcgacag ataaatactc tcaacatgtt cttgatgtcg atatggctca agctcttgat      2040
     ggacatacag tggaagaaac atatttgcat gttgaaaaga ttatttcgat agcaaagaaa      2100
     tatgacgtcg atgctataat tcccggctat ggtttcttat ctgagaatgc atcctttgcc      2160
     gatagatgtg aacaagaagg tatacaattt attgggccta ggggtgaaac aattagaaaa      2220
     ttaggtctaa agcattccgc aagagaagtt gctaaaagtg ctggagtacc gctagtgcct      2280
     ggttctccac tagtcaagaa cgctgatgag gcctttacga ttgcaaaaaa cattggatac      2340
     ccagttatgg tgaaatcaac cgctggtgga ggtggaattg ggttacaaaa agttgataat      2400
     gagcaagaca tgagaaaagc atttgagact gttaagcatc agggatcatc ctatttcggt      2460
     gactcaggag tttttatgga aaaattcatt gataacgcaa gacatgttga ggtccaaatt      2520
     atgggggatg gtaagggcaa gacacttgct ctaggtgaac gtgattgctc attacagcgt      2580
     aggaatcaaa aagtaataga agaaacaccg gctcctaacc ttcctagaga gactagacaa      2640
     aaaatgctaa cagctgcaga gcgattagga gcatacctaa attatagagg tgcaggaact      2700
     gttgagttta tttacgacga acagagagat caattttact tcttagaagt caacaccaga      2760
     ttgcaagtcg aacatcctat cactgaaatg gtaacaggcc ttgatttggt tgaatggatg      2820
     attaaaatat ctgccggtgt aatgccttct ctcgatgaat ttaacatttc acaaaatgga      2880
     gcttcaatag aagtacgtgt atatgcagaa aatcctttaa aagattttag accatctcca      2940
     ggagagcttg tcgatgtaca gtttccaaac gactgccgag tggatacttg ggttaagaag      3000
     ggaaccaaaa tctcccctga gtttgatcct acattggcta aaataattgt tcatggcaaa      3060
     gatagaaatg aggctatttt aaaaatgaag aaagcattga atgaaaccaa aatatatgga      3120
     tgtgttacaa atgtcgacta cttaaaaagt ctgatctctt cagagatgtt caggaatgcg      3180
     cagttatcaa ccaactatct taacacctat gaatatagtc catcagcagt cgagataatt      3240
     gaacctggcg cgctaaccac tattcaggac taccctggca gggtcaacta ttggagaatt      3300
     ggcgttcctc catgtggtcc tatggacaat tattcattca gattggctaa tagaattgta      3360
     ggtaatgatg aaagaacacc aggcatcgaa ataactttaa caggtcctac tataaagttt      3420
     tactctgata gtttagtatc catagcaggt ggtgaggtat gttgtaaatt ggatgaaaag      3480
     aaaataccaa tgtttgagcc tatatctgtc aaaactgggt ccgttctttc aattggtaaa      3540
     attgtaaaag gcagtcgagc atacctagcc attaggggag gtatcgatgt acccaaatac      3600
     atgggatcgt tttccacctt cactatgggt aatttaggag gatttaatgg tcgagcattg      3660
     aaaagaggtg atgtcttgtc tcttcctcag cagtttgact ctgaacacgg tattccatca      3720
     ccatgctttt caccagaaaa agctcctata tatgttagac ctgatatacc aaatgatggc      3780
     gtctggacta ttggtgttct agctggtcct catggcgcac ctgatatttt cgaatccgaa      3840
     ggtatgatgg agttcttcaa atccgagtgg aaagttcatt acaattctaa tagatttggt      3900
     gtaagactga ttggaccaaa gcctaaatgg tcccgtactg acggtggtga aggaggtctt      3960
     catccttcta atactcatga ttacgtttac tcgcttggtg ctatcaattt tactggagat      4020
     gaacctgtta taattacttg tgatggacct tctctcggtg gatttgtatg ccaagctgtc      4080
     gtcagtgaag cagagatgtg gaaggttgga caattgaagc caggtgatac aattaatttt      4140
     accccaatag attggcaaag cgctagaaac ttgaaagaaa atcaagatgt tattatcaat      4200
     gatatgtcct cgtgtgcgct tcagaagcta agtgatcaac cactacttaa atcaccagaa      4260
     gacccgatac ttttccaaaa agatggtcaa gaattgcaat cgcctaaagt agtttacaga      4320
     caagctgggg acagatacat cctgattgaa tatggagatg acatttttga attgaacttg      4380
     tgctacagaa taaaatcttt gatagatatt atatcccaaa gaaatacaaa agggatcaag      4440
     gagatgtcac agggtgttag atcagtattg gttgaatatg acggctatga aatttcgcag      4500
     aaagaattac ttaagacgtt aatcgcatat gaagagcaat taccccaaga aaaaaactgg      4560
     tcggtgaaat caagaatatt cagactacca atggcttttg aagataaaga aactcttgca      4620
     tgtgtgaaga gataccaaga gacaatacgc tctaaagcac catggctacc aaataatgta      4680
     gactttgttg ccgaagttaa caacttgaca catgatgata tccgtcagct aatatacaca      4740
     acgagataca tggtacttgg tgttggagat gtatttttag gatcaccgtg tgccataccc      4800
     ttggatccac ggaatagatt actaggtagc aagtacaacc cttctagaac ttttactaaa      4860
     agaggagtag ttggaatagg tggatcctat atgtgtattt atgccgcgga tagtcccggc      4920
     gggtatcaat tggttggcag aacaatccct atttgggata gattgatgtt acaatcaaag      4980
     aaagatgagc catggttatt gtccccattt gatcaaattg aattttaccc tgtctcagag      5040
     gaacaaattg atgaatatac cgatgagtgg gacaatggta attacaaaat cgatgtagat      5100
     gatgttgttt ttgatcatgg tagttacttg aaatgggttc aagataatat cgaagctata      5160
     gaggagcatc agagggccca aagaggggac aactattcaa aatttgccca aaaaatacaa      5220
     gaggcgaatg cagatttgaa acaaaccaca actgaagtta ttgaacaaaa catattagaa      5280
     gatgactgcg aatatatttt ctctgaatat gcaggcagat tctggaaacc tatagtagag      5340
     attggagcaa gcatagagaa agaccaaggt gttgctgtga ttgaggctat gaaaacggag      5400
     atgatagttt catcatctgt ggttggaaaa ctgaaaaaat tcttattcaa aaatggagac      5460
     atggttgatg ccggtgatcc tgtggcaata attcaatgct tgtaa                      5505
//

If you have problems or comments...

PBIL Back to PBIL home page