(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE240

CAGLA1_12.PE240      Location/Qualifiers
FT   CDS_pept        complement(596196..597707)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501161"
FT                   /gene_name="DEM1"
FT                   /locus_tag="CAGL0M05577g"
FT                   /product="Defects in morphology protein 1, mitochondrial "
FT                   /biological_process="regulation of cell shape"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62564.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="HOGENOM:HBG124070"
FT                   /db_xref="HOGENOM:HBG204182"
FT                   /db_xref="InterPro:IPR016610"
FT                   /db_xref="InterPro:IPR019190"
FT                   /db_xref="UniParc:UPI00003B70CD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJK6"
FT                   /transl_table=1
FT                   /translation="MTLRDVEKLRLWRLKIFRNQQPILRAKPPHASRKTQYLFQKIDNV
FT                   KSQFGTDGKGDLLWQRDGMNPYHDLYDPGDLKTHRLSVTKLLTKSWCELRFAYDLYSRL
FT                   PLFREAHLAAGERTHQKLENSEHTPVIRPQDIPQFSETVEIVEDDLHVLAASWAETITR
FT                   LIHLFSSGDAREILCHGYLNKETNQLYDPMETEVWDPSQHILISGIIDHLTLTSKNGNL
FT                   PLNNHHRSIDDSIAKLKNTRNEFAKNGLTIQISDVKTRTRKFIPPQESVQNATKLQLMY
FT                   YRHFLLSLGTDSDNTYEMLLYNARIRGVDVDQPLNPANCLLIMIQMDGFVGDFVKLQNG
FT                   DGFQFPKFDNAPISHSFTLADAKHHQFLQNINSHELAGQLLNGTFAKPITLRYFAMRLA
FT                   QMYSMLTPLISEKLKVEYYHNNECFQEVEFVNDKKSLGESCRSASSFWFGKRAIEPVEA
FT                   TTFNYNQYCKHCDYRDHCAWIKDSLAKSTKLGDELTQIARRIHNI"
     atgactcttc gggatgttga gaagctgagg ctatggcggt taaagatatt ccgaaaccag        60
     caacccattc tccgtgcgaa acctccccac gccagtagaa aaacccagta cttgtttcag       120
     aagatcgaca atgtcaaatc acagttcggc acagatggca aaggcgatct cttgtggcag       180
     cgtgatggaa tgaatccata ccacgatctg tacgaccccg gagacttaaa gacccataga       240
     ttgtcggtta ctaagctttt gaccaaatcg tggtgcgagt tgcgcttcgc ttacgatcta       300
     tactcaaggc tacctctgtt tagagaagca cacttggccg ccggtgaacg cacacaccaa       360
     aaattggaga actccgagca tactccagtg atcagacctc aggacatacc gcaattctca       420
     gaaacagtgg aaatagtaga ggatgacttg catgtgttgg cggcctcctg ggcagaaact       480
     atcactaggc ttatacacct tttctcaagt ggagacgcaa gagaaatact gtgtcatggg       540
     tacctgaata aagaaacaaa ccaactctat gatcctatgg aaacagaagt ttgggaccca       600
     tcacaacata tcttgattag cggcattatc gatcatttga cgctcacctc aaaaaacgga       660
     aatcttccat taaacaatca ccatagatca atcgacgact ccattgccaa acttaagaat       720
     actcgtaatg aatttgctaa aaacggcttg actattcaaa taagtgatgt caaaacaagg       780
     acaaggaaat ttataccgcc tcaggaatcg gttcaaaatg ccactaaatt acaattgatg       840
     tactatagac attttttact aagtctaggc accgactcag acaatactta tgagatgttg       900
     ttgtacaatg caagaatacg aggtgtggat gtagatcagc cattaaaccc tgctaactgt       960
     ttgttaataa tgatacagat ggacggattt gttggagact ttgtcaaatt gcaaaacggt      1020
     gatgggtttc aatttcctaa atttgataac gctccaatat ctcattcgtt cacactagcg      1080
     gatgccaagc atcatcaatt cctccaaaat ataaactctc atgaactggc tggtcaactc      1140
     ttgaacggta cttttgctaa gcctattacg ttaaggtatt ttgccatgag acttgcacaa      1200
     atgtacagta tgttgactcc attgatctca gaaaaactaa aggtagaata ctatcataat      1260
     aacgagtgtt tccaggaagt tgagttcgtt aatgataaga aaagcttagg tgaaagttgc      1320
     aggagtgcaa gtagtttttg gtttggcaaa agggccattg aacccgtaga agctacaact      1380
     ttcaattaca atcagtattg taagcactgc gactatcgag atcattgtgc atggataaaa      1440
     gatagccttg ctaaaagtac taagcttgga gatgagttga ctcagattgc tagaagaatc      1500
     cataatattt aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page