(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE243

CAGLA1_12.PE243      Location/Qualifiers
FT   CDS_pept        complement(601941..603266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501162"
FT                   /locus_tag="CAGL0M05621g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62566.1"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B70CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK4"
FT                   /transl_table=1
FT                   /translation="MKKELKLLIYANFMLVVFILYYTFDLLMLCIDDTFQDALLDFELN
FT                   PPRDRVTGLEVHDGKPELIPKIIHQTYKTEDIPEQWKESQKKCIDLHPDYEYILWTDEM
FT                   ALKFIKEEYAWFLDTFENYKYPIQRADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVP
FT                   AFVRKTSPLGVSNNVMGSVPRHPFYLKLLNSLKHYDKYWFIPYLTIMGSTGPLFVSVIW
FT                   KQYKRWGVPENGVVRIMQPADYKKHTYSFFSISKGSSWHMDDAVFMKSLENHILSCVVA
FT                   GFIVGFIILYGEYVFYCWLCASWLGSSNDPEAESQDDEDDFIYNKGSQYYQQGHGSIFL
FT                   GTSISPLRKLNKSLFSTLYTKLVPSSSSSSASACSVSEKYSTPKLSRSVAEYYSLRKEN
FT                   SVHFNSPTPKGKRSRKDSNVRFTNFLLSDIEKLDPNVEDLTN"
     atgaaaaagg agttaaagtt gcttatatac gccaacttta tgttggtggt gtttatcctg        60
     tactatacgt ttgatctgct gatgttgtgt atagatgata ctttccaaga tgcgctgttg       120
     gactttgagc tgaatccacc tagagacagg gtcactggtc tagaagtgca cgatgggaaa       180
     cctgagttga ttccaaagat tatccaccag acttacaaaa cagaggatat acccgagcaa       240
     tggaaagaat cacagaagaa atgtatagac ctgcatccag attatgagta tatcctgtgg       300
     acagatgaga tggctctaaa attcatcaag gaggagtacg cttggttcct tgacacattt       360
     gagaactaca agtatcctat acagcgtgcc gatgccatca gatacttcat attgtcacac       420
     tacggtggta tatacattga cctggatgac ggttgtgaaa gaaggctcga cccactattg       480
     aaagtgcccg cgtttgttag aaagacctcg ccgttgggtg tctcgaataa tgtgatgggc       540
     tctgtcccta gacatccttt ctatttgaaa ttgctcaact ctttaaaaca ttacgacaag       600
     tactggttta taccatacct gaccatcatg ggctcaactg gcccactttt cgtaagtgtc       660
     atatggaaac agtacaagag atggggtgtg cccgagaacg gtgtggtgag gataatgcaa       720
     ccagcagact ataagaagca cacatactca ttcttttcta tctcaaaggg ttcttcatgg       780
     catatggatg acgcagtttt catgaaatct ctggagaacc atatattgtc atgtgttgtt       840
     gctggcttca ttgttgggtt catcatcctg tatggtgaat atgttttcta ctgttggtta       900
     tgtgcctctt ggttgggttc ctcgaatgat ccagaagcag aaagtcaaga tgatgaagac       960
     gatttcattt acaacaaagg aagtcaatat taccagcaag gtcacggctc aatctttttg      1020
     ggcacaagta ttagcccttt gagaaaacta aataaaagtc tattctcaac attatacaca      1080
     aagctggtac cgtcatcgtc atcttcttcg gcatcggcct gttcagtttc agagaaatac      1140
     tctactccga aactaagcag atcagtagct gagtactatt ccttaagaaa ggagaacagt      1200
     gtacatttta acagccccac gcctaagggt aaaagaagtc gtaaggactc taacgtccgt      1260
     tttaccaatt tcctgctttc cgacatagag aaacttgatc ctaatgtgga ggacctaacg      1320
     aattag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page