(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE244

CAGLA1_12.PE244      Location/Qualifiers
FT   CDS_pept        603919..604449
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044622"
FT                   /locus_tag="CAGL0M05643g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62567.1"
FT                   /db_xref="HOGENOM:HBG174727"
FT                   /db_xref="HOGENOM:HBG396998"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniParc:UPI00003B70D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK3"
FT                   /transl_table=1
FT                   /translation="MIRNILRRSAARVRIPVTSATCASRLVMSIRLATSTRYYSNGNEG
FT                   GPAMTNGVQIPKEVLELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGVMS
FT                   LTVAGVGTYVINKQPPNKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKELHDA
FT                   LPNDAEFKVESDQ"
     atgatcagga atattttacg cagaagcgct gccagagtca ggataccggt gactagtgca        60
     acttgtgcta gtcgactagt gatgtcaata agattagcga ccagtacaag gtactatagt       120
     aatggtaacg aaggtggccc tgcaatgacg aatggtgtac agattcccaa ggaagtgcta       180
     gagttgcctt tacagcagta ccaccagcat tctgagtcat tcctggaagg gctgtttgat       240
     aacctggagg aactgagcga gaattaccct caacatattc ccgaagtgga atacagtcac       300
     ggtgttatga gccttacagt agccggtgtg ggcacgtatg tgataaacaa acagccacca       360
     aataaacaga tatggctctc ttcaccaaac tccggcccaa acagatttga tctgtataag       420
     ggagaatgga tatccctacg taataacgag actttgcttt cagtactaga caaagagcta       480
     catgacgcac ttcctaatga tgctgagttc aaagtggaat cagatcagtg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page