(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE246

CAGLA1_12.PE246      Location/Qualifiers
FT   CDS_pept        605540..606652
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438959"
FT                   /locus_tag="CAGL0M05687g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAG62569.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG124071"
FT                   /db_xref="HOGENOM:HBG397583"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI00003B70D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK1"
FT                   /transl_table=1
FT                   /translation="MSTFFGDVGLNRVSFLREDTEFIKLAFTSSEAKFIVFVNGEAFYD
FT                   ISSDGKPQLHIETSTSLKGIITTLSPLLETKDLRVDVSGVSITFLGLDDRIDGFSYKGK
FT                   YKGAPYFGLEFKVDDKTLLTPKDIEFTTSLQRMDRESLFMIDNHSATLYSHAKMYLDWL
FT                   NKYKFCPGCGSVIYPVHGGTKLQCSSAPEVNCNVRNARVNNVCFPRSDPVIIIAMANED
FT                   YSKICLARSFRKHGNFVMYSTIAGFMEPGESIENACAREIWEETGVHCDVDNVKIISSQ
FT                   PWPYPANLMIGCLGIVKFNNKDEIIDLGNDPELMDAQWFDTNEVRAAMDSYKTGWLVPF
FT                   KDEINFPGETAIAHHLIRHVCKQHQRLQKL"
     atgagtacct tttttggtga tgtgggtttg aacagggttt cattccttag agaggacacg        60
     gaattcataa aactagcatt tacctcatct gaagccaaat tcattgtatt tgtcaatggc       120
     gaagcctttt atgacatcag ttcagatggt aaaccacagc tgcatataga gacctctact       180
     agcttaaaag gaatcataac gaccttgagc ccattgttag aaacgaagga cttaagagtg       240
     gatgtctcgg gtgtgagtat tacattcttg ggtttagatg accgtattga tgggttctca       300
     tacaagggta agtacaaagg tgccccatac tttggacttg agtttaaagt agatgataaa       360
     acgttgctca cgccaaagga cattgagttt accacatcct tacaaagaat ggatcgtgag       420
     agcttgttca tgatcgataa tcacagcgca actctttatt ctcatgcaaa aatgtacttg       480
     gattggttga acaaatataa attttgtcct ggttgtggtt ctgttattta ccctgttcat       540
     ggtggtacca agctgcaatg cagttcagct ccggaagtca attgtaatgt aagaaatgct       600
     agagttaaca atgtatgctt cccaagaagc gatccagtta ttattatagc tatggcaaat       660
     gaagattact cgaagatatg cctagcaaga tctttccgta aacatggtaa ctttgtgatg       720
     tattctacca tcgccggctt tatggaacct ggtgaatcga tcgagaatgc atgtgccaga       780
     gagatttggg aagaaaccgg agttcattgt gatgtggaca atgtcaagat aatatcttct       840
     caaccatggc catacccagc caacctcatg attggttgtc tagggattgt aaaattcaat       900
     aataaggatg agattattga tcttggtaat gaccccgaac taatggacgc tcagtggttt       960
     gatactaacg aggtgagagc tgcaatggat agctacaaga ctggctggct cgttcccttt      1020
     aaggatgaga ttaacttccc tggagaaaca gcaatagccc accacttgat cagacacgtc      1080
     tgcaaacagc atcaacgctt gcagaaatta tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page