(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE25

CAGLA1_12.PE25       Location/Qualifiers
FT   CDS_pept        78392..79429
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436688"
FT                   /locus_tag="CAGL0M00660g"
FT                   /product="Similar to uniprot|P32366 Saccharomyces
FT                   cerevisiae YLR447c VMA6"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="CAG62350.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG020908"
FT                   /db_xref="HOGENOM:HBG317755"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR016727"
FT                   /db_xref="UniParc:UPI00003B6FF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK70"
FT                   /transl_table=1
FT                   /translation="MEGLYFNVDNGFLEGLIRGYRNGLLTNNQYINLTQCDNLDDLKLQ
FT                   LSSTDYGNFLSQVSNDALTTSVMQEKASEKLYKEFGYIRDQSSGLTRKFIDYITYSYMI
FT                   DNVALMITGTIHERDKSEILSRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPFFR
FT                   DCFDAADELDDLNIEIIRNKLYKAYLEDFYKFVSEEIDEPSREIMQTLLGFEADRRSIN
FT                   IALNSLQSPDLDPALKKQLLPEIGKLYPVATEQLANAKDFESIRAVLGQVPDYRNALES
FT                   GSLEDHFYKLEMDLCRDAFTQQFTISTIWAWMKSREQEVRNITWIAECIAQNQRERINN
FT                   YISVY"
     atggaggggc tttactttaa cgtcgataac gggtttctcg aagggttgat ccgcgggtac        60
     aggaacgggt tgttgacgaa caaccagtat atcaacttga cgcaatgcga taaccttgac       120
     gatctgaagt tgcagctgtc atctacagac tacggtaatt tcttgtcgca agtgtcgaat       180
     gacgcgctga ccacgtctgt gatgcaggag aaggcgtctg agaaactgta caaggagttt       240
     gggtacattc gggaccagag cagcgggcta acgcggaagt ttatcgacta tatcacttac       300
     agctatatga ttgacaacgt tgcgttgatg atcactggaa ccattcatga gagagacaag       360
     tctgagatcc tcagcaggtg ccaccccttg ggttggtttg acacacttcc cacgttatct       420
     gtcgccacgg atttggagtc gctttatgag actgttcttg tggatacacc attggcgcca       480
     ttctttagag attgcttcga tgcggccgac gaactggatg acctgaatat agaaatcatc       540
     agaaacaaac tgtacaaggc atacctggaa gacttctata agtttgtttc agaagaaatc       600
     gacgaacctt cccgtgaaat aatgcaaact ttgcttggtt ttgaagctga taggaggtct       660
     ataaacattg cgctaaactc attacaaagt ccagatctag atcctgcttt gaagaagcag       720
     ttgctaccgg aaattggtaa actgtatcct gtcgccacag aacaactggc caacgctaag       780
     gatttcgaat ctatcagagc tgtgctgggt caagttcctg actatagaaa tgctctagaa       840
     tctgggtcgc tagaagacca tttttataaa ctagagatgg acctttgtag agacgctttt       900
     acacaacagt tcacaattag tacaatatgg gcatggatga agtcaagaga acaagaagtg       960
     aggaatatca cctggatagc tgagtgtatt gctcaaaacc aaagggagag aatcaacaac      1020
     tatatatcag tgtattga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page