(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE251

CAGLA1_12.PE251      Location/Qualifiers
FT   CDS_pept        613807..614760
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196065"
FT                   /locus_tag="CAGL0M05797g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAG62574.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG124072"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B70D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ6"
FT                   /transl_table=1
FT                   /translation="MALVLGYLGTGYQGIQYNPPAHTIDNELFKALVATNCISQSNSDD
FT                   FSKSSFSRATRTDKGVHALTNLVALKMQRYEVPQQVKAELNEILPDDIRIWDVVPVKKK
FT                   FNARVMAGTRHYRYVIPTFLLQCGPHSDLSTSQLARFKNIWNMFLGTHNYYNFTPRRKD
FT                   TNADSPQNMRHMYSIQVSDPFTIAGSTQWLSIAIHGQSFLLHQIRKMVHYALSEYHRSS
FT                   SDTKSMELLETVDPDLTSATALDTPTEQYIPLAPAAGLYLHHPTFEGYNNQPAARRLQV
FT                   LDLSGYPACATFEDRIHTEIARSEHVFHEYMAVIRQ"
     atggcacttg tgctcggata tttgggtact gggtaccaag gtatacaata caacccgcct        60
     gcccatacta tcgacaacga gctatttaaa gcgttagtgg ctactaattg tatatcacaa       120
     tccaactctg acgacttttc aaagagctca ttctcccgag ccacgcggac cgataagggt       180
     gtacatgcgc tcaccaactt ggttgcgtta aagatgcaaa ggtatgaggt gccgcagcaa       240
     gttaaggcag aattgaacga gattctaccc gatgatatac gcatatggga tgtcgtgcca       300
     gtaaagaaaa aattcaatgc tagggtcatg gcgggaacaa gacactaccg gtatgtgatc       360
     ccaacatttt tgctccaatg cggtccccat agcgatctct cgacctctca gcttgccagg       420
     ttcaaaaaca tctggaatat gtttcttggt acgcacaact actacaactt cacaccaaga       480
     agaaaagaca caaacgccga ctccccacag aacatgagac atatgtactc gatccaggtc       540
     tctgacccat tcaccatagc cggttccact cagtggctgt ccattgccat acacggccag       600
     tcgttcctgt tacaccagat cagaaagatg gtgcactatg cgctatcaga gtaccatagg       660
     agctcgagcg ataccaaaag catggaactc ttagaaactg tagatcccga tcttacatca       720
     gcgactgcct tagacacacc cacggagcaa tacataccgc tagcgccagc cgcagggttg       780
     tacttgcacc acccaacgtt cgaaggctac aataaccagc cagctgctcg acggctacag       840
     gttctagacc tcagcggata ccccgcatgc gcgactttcg aagatcgcat acacacagag       900
     atagcccgca gcgaacatgt cttccacgaa tacatggctg tgatacgcca atag             954
//

If you have problems or comments...

PBIL Back to PBIL home page