(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE253

CAGLA1_12.PE253      Location/Qualifiers
FT   CDS_pept        615972..617207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438961"
FT                   /locus_tag="CAGL0M05841g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62576.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B70D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ4"
FT                   /transl_table=1
FT                   /translation="MKEWLIWVVEVFIWWGQLWFCGDIDRNYFERSVAVKTKYDGVRRR
FT                   EYFVPLKLATNSYDDMAVFTELEYSPKRENATLLMLVRNWELSGALASMRSLEDRFNRK
FT                   YNYDWVFLNDVPFDEDFMLATSAMASGMTYYGMVPPHEWSTPTWINEDQYAQCLRDMEG
FT                   SGVIYGGSRSYRNMCRFYSGFFYKQDLLKNYDYYMRVEPNVEYFCDFPYDPFKVMRANK
FT                   YKYGFLMSLYEYENTIPHLWHAVEDYINEYGHKLNFENNSYSFLVDKDHFSPNTMGIIE
FT                   SHTDYNLCHFWSNFEVGDLSFFRSKEYEEFFDFMDQKGGFYYERWGDAPIHTIAASLLL
FT                   NTSEVIHFDELGYRHEPYLSCPRSLGIQLQQRCLCDVNSDVNLDISLASCLPRWWRNGS
FT                   GKTFVKPKQFTD"
     atgaaggagt ggcttatttg ggtagtagag gtgtttatat ggtggggaca gctatggttc        60
     tgcggtgata ttgatcgcaa ctattttgag agaagtgtgg cagtgaagac aaagtacgat       120
     ggggttaggc gacgtgagta ttttgtgcca ttgaagctgg ccacgaatag ttatgacgac       180
     atggctgttt tcaccgaact agagtattct cccaaaaggg agaacgcaac gttgttgatg       240
     cttgttagaa attgggaatt gagtggagcc ctggcgtcca tgcggtcgtt ggaggataga       300
     ttcaacagga agtataatta tgattgggtc ttcttgaatg atgtgccgtt tgatgaggat       360
     ttcatgctgg caacatctgc tatggctagt ggtatgactt actatggtat ggtgccgccc       420
     catgaatggt ctactccaac ttggattaat gaggaccagt acgcacagtg cctgagagac       480
     atggaaggca gcggtgtcat atatggtggt tcaagatcat acagaaatat gtgcaggttc       540
     tactctgggt ttttctacaa gcaggatctt ttgaaaaact atgattacta catgagagta       600
     gaacccaacg ttgagtattt ctgtgacttc ccatatgacc catttaaagt catgcgtgca       660
     aataaataca aatatggctt cttaatgtca ttatatgagt acgaaaacac tattccacac       720
     ttgtggcatg cagttgagga ttacattaac gaatatggtc acaaactcaa ttttgaaaac       780
     aattcctaca gttttttagt ggataaagac catttcagcc caaataccat gggtatcata       840
     gagtcacaca ccgattacaa cctatgccat ttctggtcca attttgaagt tggagattta       900
     agtttcttca gaagtaaaga gtacgaagag ttcttcgatt tcatggatca aaagggagga       960
     ttttattatg aaagatgggg tgatgcacca atacatacaa ttgctgcatc tctactattg      1020
     aacactagtg aagtgataca tttcgatgaa ttgggctaca gacatgaacc atatctctcc      1080
     tgcccgagat ctctgggtat acaattacaa caaagatgcc tgtgtgatgt aaactccgat      1140
     gtcaatttgg acatttcatt ggcaagttgt ctacctagat ggtggaggaa cgggtctggc      1200
     aaaacgtttg ttaaacccaa acaatttaca gattaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page