(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE255

CAGLA1_12.PE255      Location/Qualifiers
FT   CDS_pept        complement(620069..621535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196067"
FT                   /locus_tag="CAGL0M05885g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62578.1"
FT                   /db_xref="HOGENOM:HBG124074"
FT                   /db_xref="InterPro:IPR007174"
FT                   /db_xref="UniParc:UPI00003B70DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ2"
FT                   /transl_table=1
FT                   /translation="MSHGRVVPWKDEKELDELKQWFYSVSDGNDLRLKAISRVKSYKLK
FT                   GSQYLPHVIDSTAQLTSAILADEKHGGSDDLFDKMNIRMTYTMAMIRFVNGVLDPSQQT
FT                   QFAIPLHTIARNVGLPSWFVDLRHWGTHERDLPNIDMLRMAAKDALQWLWKNYWDNDEL
FT                   DDSLNEDDALDEETIRQQEYLDRLRLKIELWKNNNTELRDNCNIWLEEKNSIISSDNFV
FT                   VDDGGKTNSSKADQLVKFIDETITEVKYLWKVIRDKNLFMRTFLKFYDDLFLSLLVRKL
FT                   PGFDLELIKWMFSAYTVLYQDGNLELKQDLYAIRSRFSKWIVLEKELLSPLVSLLNIRS
FT                   RISELSELFNPDMTFMQFKLLSLLVKKLEEDIGNHNWRRKKRRKDNNDTTAKLNDTQRQ
FT                   WNQLVADYLKSHVMLEEEKQFSMYGAKAKAVVKKAKEASVHNNELSDDLQKLKQRLLNL
FT                   KSKESVKPPSIETFNWDSHDDWQPKPFGIL"
     atgtcgcatg gaagagttgt gccgtggaag gatgagaaag agttggacga attgaagcaa        60
     tggttttata gtgtcagtga cggtaatgat ctcaggttga aggctattag ccgagtgaag       120
     agttataaat tgaaaggttc tcagtacttg ccacatgtta ttgactcgac cgcgcaattg       180
     acaagtgcta ttcttgcaga tgagaagcat ggtggctctg atgacttatt tgacaagatg       240
     aatatacgta tgacgtacac aatggcaatg atccggtttg tgaatggtgt gttagatcct       300
     tcgcaacaga cacaatttgc cattccattg cataccatag caagaaatgt gggtctgccg       360
     tcttggtttg ttgacctaag gcattggggt acgcatgaga gagatctgcc aaacattgat       420
     atgcttcgca tggcagcaaa ggatgctctg cagtggttgt ggaaaaatta ttgggataac       480
     gatgagcttg atgactcact gaatgaggat gatgctctgg atgaagagac gataagacag       540
     caagaatatt tggatcggtt gagattaaaa attgagctat ggaaaaataa caataccgag       600
     ctaagagata actgtaatat ttggctcgaa gagaaaaata gtattattag cagtgataat       660
     tttgtagttg atgatggtgg aaaaactaat tccagtaaag ctgatcaact ggtaaaattt       720
     attgatgaaa cgataacgga agtaaaatat ctctggaaag ttatacgtga taagaatcta       780
     ttcatgagga cttttcttaa attttatgat gacctatttt tgagcttgtt agtacgtaag       840
     ttgcctggct ttgacttgga attaattaaa tggatgtttt cagcgtatac ggttctgtac       900
     caagatggta atttagaact gaaacaagat ttgtatgcga tcagatcaag atttagtaaa       960
     tggatagtat tagagaagga attattgtca ccacttgttt ccctgctaaa tatcagatcc      1020
     agaatctctg aactatcgga gctattcaat ccagatatga catttatgca attcaagtta      1080
     ctatcgctgc tcgtcaaaaa gcttgaagaa gatattggca atcataactg gaggagaaag      1140
     aaaagaagga aagataacaa cgatacaaca gccaagttaa atgatacaca gagacaatgg      1200
     aatcaattag tggcggatta tcttaaatcg catgtgatgt tagaggagga aaaacagttc      1260
     agcatgtatg gtgctaaagc aaaagctgta gtaaagaaag caaaagaagc atcggtgcat      1320
     aacaatgagc ttagcgatga cctacagaaa cttaagcaga gattgttgaa tttaaaatca      1380
     aaggaaagtg tcaaaccccc atccattgag acgtttaatt gggatagtca tgacgattgg      1440
     caaccaaagc catttggaat attataa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page